CAZyme Information: PITG_10754-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_10754-t26_1-p1
• CAZy Family: GH31
• CAZyme Description: beta-glucan synthesis-associated protein, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
525	DS028137|CGC1	59164.67	4.4632

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028137:1054136-1055826(+)

Full Sequence      

MQLAQYVAVSVLTLWWTTTTVFVTAKNNSLAYPTKSGLLPWVDADTPKNKYVYTSSRGRR
WDLVMSDEFNVANRSFRPGDDHMWTSLEKPDGVNGALELYSHNMTSTKCDDDGTCYFYIE
TIDEVNVIHVYNMYTHPPSFEDVYFWYRGAMVQSWNKFCYQGGMLEVRAQLPGVTDPDSG
NPDVALGEDGKVQNTKYYPTWPGIWMLGNLGRAIFSASTNRMWPYSYNECDADVFDPSFQ
RISACDSNPGYGLNPNQGRGAPEIDVLEGSGLAISSSLQIAPGMPDDYRLFPVDTSTGDF
SYCLYSYNCLTPGANYIDVPASYYEQERGHKSWYQGLRYAANNYCVTENTCAVDTCPASG
DVNADLSFIDGGKNHWGINSNGTCYPLMNSYLGSYLCDPDNTFSKCASPRNETSTPKSNA
MKPFNYQMDAISSNWPIHFGAYTGFYDYQVEWVTGENGYVRWLLHGEPLFEVTTESVVNV
PQNANKTNPKKIMIEEPLYVIFNVALSSSQHDEHYLRLFPNVHED

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	67	289	1.6e-62	0.6012269938650306

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397841	SKN1	2.97e-51	27	282	82	313	Beta-glucan synthesis-associated protein (SKN1). This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
185689	GH16_fungal_KRE6_glucanase	1.50e-41	63	509	1	271	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
225182	BglS	1.26e-07	42	288	30	224	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185693	GH16_laminarinase_like	0.001	66	209	2	103	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185684	GH16_lichenase	0.007	424	494	116	180	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28149.1|GH16	6.56e-270	32	509	29	525
UIZ27810.1|GH16	4.68e-262	19	509	50	564
UIZ28151.1|GH16	6.75e-260	32	509	30	528
UIZ28152.1|GH16	3.78e-258	23	509	6	513
UIZ28150.1|GH16	5.60e-233	65	507	1	461

PDB Hits     

PITG_10754-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33336|SKN1_YEAST	1.02e-33	42	282	359	574	Beta-glucan synthesis-associated protein SKN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKN1 PE=1 SV=1
sp|P32486|KRE6_YEAST	1.59e-33	42	282	307	522	Beta-glucan synthesis-associated protein KRE6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE6 PE=1 SV=2
sp|P87024|SKN1_CANAX	1.43e-31	31	282	324	549	Beta-glucan synthesis-associated protein SKN1 OS=Candida albicans OX=5476 GN=SKN1 PE=2 SV=1
sp|P87023|KRE6_CANAX	4.66e-31	31	282	320	552	Beta-glucan synthesis-associated protein KRE6 OS=Candida albicans OX=5476 GN=KRE6 PE=2 SV=1
sp|O13941|YEPB_SCHPO	6.06e-30	42	301	219	438	Uncharacterized beta-glucan synthesis-associated protein C23H3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23H3.11c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.004896	0.995074	CS pos: 25-26. Pr: 0.9422

TMHMM  Annotations     

There is no transmembrane helices in PITG_10754-t26_1-p1.