CAZyme Information: PITG_10448-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_10448-t26_1-p1
• CAZy Family: GH30
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
491	DS028135|CGC1	56147.81	9.4028

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028135:1277793-1279463(-)

Full Sequence      

MPAFGWGTRIRDSRFLSNVYIRGLGAFMLFCSVCSLSQQYAFVSERGLASTSSGYPTEKP
TEKLTKKPTEKPTENPTEKPTAKPSEKPKRIAEPRQAIKKGSKGILLCLHDGILELGISL
IRELRCLGNKESIEVHHCHDLTKPSVDLLFGLDDNIQVIDLCERYVIKKVLSDTMARSFQ
SYWIKPLAMHFTSFEELIFLDADAILLKDPAVLRHNEGYKKNGTLFFYDRVINNNQYLNK
KTDKGSIYLHQWLKSFDYKRFGLTFTDPSPALKKSFAYRGKTAHEQDSSMLLINKRHAEK
AMSVLWFLITEHRFIYEFSWGDKEAFWLSYEFSHTPYFFSPWGASVVSATSNKDMERHPD
TLCGSLAHFEPTLNASAPAELLYVNGRSLVDPVPFRLHKLKLLQPNLVFNMMPTHVTPRQ
VRREPSGKGEWPECMTGMGSTPVPPQLLPNLWRRRQHFQAISMGFIEPLLECSNPGDRLP
EVPEPLKKAKK

Enzyme Prediction     

No EC number prediction in PITG_10448-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	103	364	4.9e-46	0.9659090909090909

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	4.04e-27	102	369	1	272	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
282710	PT	1.76e-08	56	89	2	35	PT repeat. This short repeat is composed on the tetrapeptide XPTX. This repeat is found in a variety of proteins, however it is not clear if these repeats are homologous to each other. The alignment represents nine copies of this repeat.
282710	PT	2.55e-07	52	86	2	36	PT repeat. This short repeat is composed on the tetrapeptide XPTX. This repeat is found in a variety of proteins, however it is not clear if these repeats are homologous to each other. The alignment represents nine copies of this repeat.
236940	PRK11633	7.82e-04	56	104	99	147	cell division protein DedD; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA22801.1|GT71	1.48e-116	95	472	51	430
CCA15193.1|GT71	2.65e-115	102	472	131	515
BAP68847.1|GT71	1.84e-91	102	391	65	365
AIG56246.1|GT71	1.63e-64	102	443	64	435
AIG56397.1|GT71	6.03e-60	102	457	91	453

PDB Hits     

PITG_10448-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P53745|MNT4_YEAST	2.13e-16	97	386	192	482	Probable alpha-1,3-mannosyltransferase MNT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNT4 PE=3 SV=1
sp|P53059|MNT2_YEAST	1.92e-14	99	352	171	428	Alpha-1,3-mannosyltransferase MNT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNT2 PE=1 SV=1
sp|Q59YS7|MNN14_CANAL	1.19e-12	103	329	276	499	Putative alpha-1,3-mannosyltransferase MNN14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN14 PE=2 SV=1
sp|Q5AGA9|MNN13_CANAL	2.94e-12	103	353	332	601	Putative alpha-1,3-mannosyltransferase MNN13 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN13 PE=2 SV=2
sp|Q59VL7|MNN15_CANAL	8.42e-11	94	386	254	576	Putative alpha-1,3-mannosyltransferase MNN15 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN15 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.992886	0.007119

TMHMM  Annotations     

Start	End
20	42