CAZyme Information: PITG_10344-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_10344-t26_1-p1
• CAZy Family: GH30
• CAZyme Description: UDP-N-acetylglucosamine-peptide N-acetylglucosaminyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
744		84081.45	5.9207

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028135:874202-876652(-)

Full Sequence      

MVQLKEVAEQVVQQNNTKVLQDLSFPSVFQYLGVAQYSLGDLEEATKTFELAVKVNENDS
QSWVHLGNCYLFQKRLPEAVAALEVGVKQKGSVKSLYALVKARNWMADWEDREDSLGQLR
RRAYDELEARAEILCCDERTNLNLQAPELRIGFVSSDFGVHPVSSLLRGLLALLSSPDHQ
TKVYCFSLSDASSWWSRNISRTVDFMISLNGKNTLDAAKLIQSYGIHVLVDLNGHTLLSG
ISIFTHRPAPVQVAYLGYPKTTGYPSIDYIVSDGVATPAETSGGSFSEKLLLLPTHYIVN
DHLQMLGHTIQGKRPRLSTFFDLDDYTFVFATFSNWQKMDPSVFSAWMEILARVPSSVMW
FQEYFGHEGAITNLRNEAEAHGINGKRLIFSPLDPWIDHTYRKRIADLVLDTSMKNGHTT
VLDALCAGVPVITLEGDQMSNRATSSALNALDLHDMTVHSIKEYVEVAVYLATHKHVLEK
LRKKVEDNRLHYPLFDTAKYATKFEESIKAAWQLKKSRLRGPTREMHIFQSTEASAVWPR
DFPVLSAKEDSNAEDEYVVRVQNALDTQQPIQLHIGGHVKDPDWWIVDANDGDIVDFVMY
ISNLYAFPDNSVDVLYSSHVLEHCTHGFGRELEHTLREWHRVLRPGGQLLVSVPNLFALA
TLFTNESIPHQDRVWIMTVIYGGQIDQYDLHKVGFDEAILLAYLTQAGFCEFTRYDDFGL
FADSSILVVHDTPISLNIQAKVCK

Enzyme Prediction     

No EC number prediction in PITG_10344-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	12	520	2.4e-97	0.5872340425531914

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226428	Spy	3.80e-78	19	514	94	614	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
404688	Glyco_transf_41	3.28e-65	149	501	81	540	Glycosyl transferase family 41. This family of glycosyltransferases includes O-linked beta-N-acetylglucosamine (O-GlcNAc) transferase, an enzyme which catalyzes the addition of O-GlcNAc to serine and threonine residues. In addition to its function as an O-GlcNAc transferase, human OGT also appears to proteolytically cleave the epigenetic cell-cycle regulator HCF-1.
226975	COG4627	1.60e-29	571	740	7	183	Predicted SAM-depedendent methyltransferase [General function prediction only].
400514	Methyltransf_11	1.15e-10	607	651	55	94	Methyltransferase domain. Members of this family are SAM dependent methyltransferases.
276809	TPR	5.90e-10	17	84	25	93	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALF56465.1|GT41	2.64e-78	139	514	9	380
ALF56607.1|GT41	8.17e-74	149	514	17	373
AGA31831.1|GT41	7.05e-71	149	740	189	733
BAY76728.1|GT41	6.84e-70	149	514	693	1049
QTA91412.1|GT41	7.75e-70	151	519	279	638

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5A01_A	3.25e-51	149	513	235	696	O-GlcNAc transferase from Drososphila melanogaster [Drosophila melanogaster],5A01_B O-GlcNAc transferase from Drososphila melanogaster [Drosophila melanogaster],5A01_C O-GlcNAc transferase from Drososphila melanogaster [Drosophila melanogaster]
6Q4M_A	6.99e-51	141	513	230	707	Crystal structure of the O-GlcNAc transferase Asn648Tyr mutation [Homo sapiens]
6IBO_A	9.50e-51	141	513	230	707	Catalytic deficiency of O-GlcNAc transferase leads to X-linked intellectual disability [Homo sapiens]
5NPR_A	1.21e-50	141	513	224	701	The human O-GlcNAc transferase in complex with a thiol-linked bisubstrate inhibitor [Homo sapiens]
5NPS_A	1.22e-50	141	513	225	702	The human O-GlcNAc transferase in complex with a bisubstrate inhibitor [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Y0|SEC_ARATH	5.02e-63	149	514	592	954	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana OX=3702 GN=SEC PE=1 SV=1
sp|Q8CGY8|OGT1_MOUSE	1.42e-49	141	513	548	1025	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus OX=10090 GN=Ogt PE=1 SV=2
sp|P81436|OGT1_RABIT	3.42e-49	141	513	548	1025	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus OX=9986 GN=OGT PE=1 SV=2
sp|O15294|OGT1_HUMAN	4.58e-49	141	513	548	1025	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3
sp|Q27HV0|OGT1_PIG	1.10e-48	141	513	548	1025	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa OX=9823 GN=OGT PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PITG_10344-t26_1-p1.