CAZyme Information: PITG_10027-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_10027-t26_1-p1
• CAZy Family: GH30
• CAZyme Description: alpha-N-acetylglucosaminidase (NAGLU), putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
684	DS028134|CGC3	79104.70	5.9138

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028134:1406428-1408552(+)

Full Sequence      

MAYGLQWYLKTALHTQTDWDNHKLQLPYVLPKVKQHVRHKRSAKFSYYQNVCTVSYSSWT
WGWAQWEKHIDWMALNGINMPLAFTGQEKVWQNTFQKHYNVSSAGLNKFFAGSAFLAWGR
MGNLRGSWVKGPLPQAFIDSQYALQLKILNRMREFGMIPALPAFAGHVPEEMKALFPNAK
FTRSPNWGDFSDEFCCVYMLDFSDPLYYDIGKTFLEEQRALYDYTSSLYQCDTYNEMDPD
FTDPAKLQAASRAVIDSMTAADANAVWLIQGWLFENSPDYWTKNRVKAYLDGVSNEKMII
LDLYSEVRPVWSKMDNYFGKSWVYCVLHNFGGNTGMRGDLATLGTAPVQASRDSNGTMIG
VGLTMEGIYQNYVVYDLTLQMAWVDTPLDMDEWVPSFAAQRYHSQDVHTERAWGFLLQSV
YNRTLGFGGVTKSLICLIPHWKLVRDGFMPTSITYDPMDITRAWKELLLAGSELHAVDTY
RHDLVDVTRQFLSDHFMAQYLHLKEMYEGKTQPAHQLCAWTERMLLTIERMDEILATNED
SLLGNWIADARALAEESESIESSNLQDYYEYEARNQVTRWGDNNSETIHDYAGKEWAGLV
KGYYLPRWRMWLGEVCQAYTQGRTINKEVVKKARIAFELKWQLSHEHYPTTTVGDALVVS
QRIYDEFADLNIVQPWASQLVMQK

Enzyme Prediction     

EC	3.2.1.50:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	1	664	2.4e-216	0.9743589743589743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398659	NAGLU	2.26e-179	47	383	2	331	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
404009	NAGLU_C	8.56e-95	393	661	1	258	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
404008	NAGLU_N	1.93e-06	1	31	51	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56008.1|GH89	1.34e-300	1	668	81	739
AIG55486.1|GH89	1.36e-292	1	668	78	730
AIG56414.1|GH89	5.42e-239	1	664	88	745
AIG56322.1|GH89	3.11e-218	1	667	86	747
AIG55749.1|GH89	7.64e-214	1	681	84	764

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	9.33e-157	2	676	63	720	Crystal structure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	4.66e-75	1	612	224	821	Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	5.20e-75	1	612	232	829	Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	4.35e-74	1	612	247	844	CpGH89 (E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9FNA3|NAGLU_ARATH	5.25e-169	1	667	105	804	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1
sp|P54802|ANAG_HUMAN	9.51e-156	2	676	86	743	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000085	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PITG_10027-t26_1-p1.