CAZyme Information: PITG_09906-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_09906-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: arabinogalactan endo-1,4-beta-galactosidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324		34983.60	9.1676

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028134:640840-641874(+)

Full Sequence      

MEASEGAKWISTAGKTTTIESILGSGGMDSVRLRLWTSGDYNLTYTLSMAKRFSKAGYKI
YLDMHFSDTWADPTKQGTPKGWDSTSITTLSTAVKAYVTSTLRTFTSAGVNIDILSLGNE
VTYGMLWPSGRVSNGDYSEFATLWKAARQGVTAAAAAGTKKPKVMIHIDNGWRYSSVSAF
FKGLFATGIVTTSDVDVFGFSYYPFYGTGATISALTSSLTQIANTYKKPIYIAETDWPTQ
CTKVTLSASYPANASGQRQWVAAIMSVLNGLPNGLGAGIFYWEPAYLKVAGLGSSCESAL
LFSVNWANWPTTYATALSSVYMYA

Enzyme Prediction     

EC	3.2.1.89:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	4	305	1.8e-80	0.9298245614035088

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
311610	Glyco_hydro_53	2.68e-87	1	305	12	323	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
226385	GanB	4.01e-57	6	316	55	360	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO16178.1|GH53	1.06e-103	15	320	64	391
USW53574.1|GH53	7.93e-99	6	323	43	386
ATZ54814.1|GH53	9.66e-98	16	323	56	379
CCD47618.1|GH53	9.90e-97	16	312	56	368
CCA76188.1|CBM1|GH53	3.63e-94	1	323	103	420

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1FHL_A	8.19e-78	5	301	18	316	Crystal Structure Of Beta-1,4-galactanase From Aspergillus Aculeatus At 293k [Aspergillus aculeatus],1FOB_A Crystal Structure Of Beta-1,4-galactanase From Aspergillus Aculeatus At 100k [Aspergillus aculeatus],6Q3R_A ASPERGILLUS ACULEATUS GALACTANASE [Aspergillus aculeatus],6Q3R_B ASPERGILLUS ACULEATUS GALACTANASE [Aspergillus aculeatus]
4BF7_A	5.02e-75	1	306	31	335	Emericilla nidulans endo-beta-1,4-galactanase [Aspergillus nidulans]
1HJS_A	1.77e-70	1	303	14	317	Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
1HJQ_A	1.41e-69	1	303	14	317	Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Humicola insolens]
1R8L_A	3.96e-33	6	314	40	352	The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9Y7F8|GANA_ASPTU	1.48e-81	1	305	30	336	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus tubingensis OX=5068 GN=galA PE=2 SV=1
sp|A2RB93|GANA_ASPNC	9.46e-80	1	305	30	336	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=galA PE=3 SV=1
sp|Q8X168|GANA_ASPNG	9.46e-80	1	305	30	336	Arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus niger OX=5061 GN=galA PE=1 SV=1
sp|B8NNI2|GANA_ASPFN	1.38e-78	1	305	30	333	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=galA PE=3 SV=1
sp|Q2UN61|GANA_ASPOR	1.38e-78	1	305	30	333	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=galA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PITG_09906-t26_1-p1.