CAZyme Information: PITG_09466-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_09466-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: pectin lyase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
200	DS028132|CGC1	21536.05	9.6470

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028132:519069-519671(-)

Full Sequence      

MSKIWLDHIKISRIGRQFIVANNAGVSSLTISNSDFDGRTDYSASCDGRHYWTFLLYGKD
TKVSMINNYVHSTSGRSPKVGGSSDSNAIVHVANNYWADNSGHSFELGQNGFVLAEGNYY
QDTVAPEGAIYAATATTECSNYLGRSCLPNVLDKSGSLQSRSGATALSKMKGNTAVSKFS
PRAAKKLVKTTKNFGIGVIN

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	2	122	6.8e-52	0.6310160427807486

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	2.31e-13	2	123	69	189	Amb_all domain.
366158	Pec_lyase_C	0.006	25	120	123	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADN18833.1|PL1_4	6.81e-119	1	200	196	400
ACR19248.1|PL1_4	4.21e-118	1	200	287	491
ADN18834.1|PL1_4	3.91e-98	1	200	196	400
AHX74068.1|PL1_4	2.23e-97	1	200	196	400
AHX74066.1|PL1_4	2.29e-72	1	197	196	407

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	1.09e-41	4	177	164	339	Pectin Lyase A [Aspergillus niger]
1IDJ_A	1.65e-40	4	177	164	339	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1QCX_A	9.67e-39	4	197	164	358	Pectin Lyase B [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CZD4|PELF2_ASPTN	2.59e-47	2	160	182	343	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|Q8NJK6|PELF_ASPNG	1.91e-45	2	197	184	381	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	1.91e-45	2	197	184	381	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|Q2TXS4|PELD_ASPOR	2.05e-45	4	174	183	355	Pectin lyase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pel2 PE=1 SV=1
sp|B8NVB7|PELD_ASPFN	2.05e-45	4	174	183	355	Probable pectin lyase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000011	0.000038

TMHMM  Annotations     

There is no transmembrane helices in PITG_09466-t26_1-p1.