CAZyme Information: PITG_09457-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_09457-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: pectin lyase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329	DS028132|CGC1	35576.21	9.3521

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028132:288713-289766(-)

Full Sequence      

MGRLQLVITAALALAVKSASAFTIGSAPGLAAGTTGGAKGTVVYPKTNKELVDYLNASEP
LVVVLNKTFDFRGTEGKTTEIGCRPQSARECIAANNGFKSQDVILKNGMNNTGGCENGTE
TTVTYDNAYRWRMNVTSHKTIRGIGRRGVIMGKGISLKGDNIIVQNIHITELNRHLVWGG
DALYMEGTVNGTKTMNNIWIDHVKISRVGRQMLVTNKAGVATMTVSNSDFDGETDYSATC
NGRHYWTILLYGKKTGVSLLSNYVHSTSGRSPKVGDKNSSVIAHVANNYWDNLSNHSFEL
DGNALMLAEGNYFNNVENPLYKKGEGIPS

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	122	315	3.4e-77	0.9946524064171123

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	8.59e-30	122	316	3	189	Amb_all domain.
226384	PelB	1.32e-13	6	320	14	280	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	6.97e-05	118	313	15	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHX74069.1|PL1_4	8.35e-160	1	323	1	325
ADN18835.1|PL1_4	3.38e-159	1	323	1	325
ADN18834.1|PL1_4	8.19e-148	7	326	7	328
AHX74068.1|PL1_4	1.16e-147	7	326	7	328
ACR19258.1|PL1_4	1.24e-145	1	326	1	327

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	3.16e-67	25	320	5	283	Pectin Lyase A [Aspergillus niger]
1QCX_A	4.95e-66	24	316	4	279	Pectin Lyase B [Aspergillus niger]
1IDJ_A	7.75e-65	25	320	5	283	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CZD4|PELF2_ASPTN	3.39e-77	4	323	1	306	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|Q5BA61|PELB_EMENI	1.88e-76	3	316	2	298	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1
sp|Q0CYL8|PELA_ASPTN	2.58e-76	8	316	7	298	Probable pectin lyase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelA PE=3 SV=1
sp|B8N316|PELF_ASPFN	5.26e-76	8	320	8	304	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|Q2UJA7|PELF_ASPOR	5.26e-76	8	320	8	304	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000207	0.999785	CS pos: 21-22. Pr: 0.9780

TMHMM  Annotations     

There is no transmembrane helices in PITG_09457-t26_1-p1.