CAZyme Information: PITG_09259-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_09259-t26_1-p1
• CAZy Family: GH28
• CAZyme Description: polysaccharide lyase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
217	DS028131|CGC3	22952.94	9.5376

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028131:1707463-1708159(+)

Full Sequence      

MPTGSWPASKGTVYLKEPYTVKKGQTFDGGMKTYARSNVKCGGQKESGWQTAVFMVEPGA
TLKNQNGCTIQNVWWEGVCEDALSIKGGSASSVTKMIGGGARPADDKVIQHNGLGTVSIE
GFYAQDFGKLYRSCGTCGDKSRKVSLTNALAVNGKVSLVTVNKNWGDQATLQNIKIKGKK
VDVCQWSQGSTSGEPKNLGAGPSGSLCQYSTSTISYA

Enzyme Prediction     

EC	4.2.2.2:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	9	189	1.1e-65	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	8.43e-82	3	193	1	199	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADN18840.1|PL3_2	3.08e-144	1	217	31	261
ADN18837.1|PL3_2	1.83e-129	1	216	31	260
ADN18841.1|PL3_2	3.61e-95	1	214	21	250
ADN18836.1|PL3_2	9.17e-75	3	203	19	236
ADN18839.1|PL3_2	7.06e-70	1	214	23	273

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	2.87e-18	15	135	5	135	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
3B90_A	1.87e-17	33	194	8	201	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B90_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
3B4N_A	7.86e-17	33	194	126	319	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B4N_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_A Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
4EW9_A	1.52e-15	11	175	6	181	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	1.55e-15	11	175	7	182	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CJ20|PLYG_ASPTN	1.09e-57	7	203	28	234	Probable pectate lyase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyG PE=3 SV=1
sp|A1DCY5|PLYD_NEOFI	1.82e-57	7	210	22	235	Probable pectate lyase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyD PE=3 SV=1
sp|Q5BA88|PLYD_EMENI	2.55e-57	7	209	43	257	Probable pectate lyase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyD PE=3 SV=1
sp|Q4WGV9|PLYD_ASPFU	2.66e-57	7	210	23	236	Probable pectate lyase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyD PE=3 SV=1
sp|B0YB89|PLYD_ASPFC	2.66e-57	7	210	23	236	Probable pectate lyase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PITG_09259-t26_1-p1.