CAZyme Information: PITG_08912-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_08912-t26_1-p1
• CAZy Family: GH28
• CAZyme Description: pectinesterase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351		38624.21	4.9657

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028133:1652227-1653282(+)

Full Sequence      

MHSFVLPLLAVAGLASATLATADTTCNGPNARTIPPPGAIVVDVTGTFNGSYQTMAEGMA
YLPNTTEEHTIFIFPGLYQEQVLVPNLAGPLVLQGYTCDTTSYAENKVTITHTMAQRDLP
PEIKNSRNDLISTMRLKSGKGVRMYNLNVANPSGKIEKLGQAVAVYVDNTDYGFYGCNFT
GYQDTLCAHKGRELYAHSYISGAVDFVFGMQAKAWFESCDFETVGKGWITANGNTNSSNL
SEYVFNNARVFNTNASMNGTTYLGRPWYPYARVVWQNSELGDVVNPLGWSTWNKNNNNTE
NVYFKEFNNSGPGAAIDQRVAFSGQLNASVKITDLLGEDFKTEWWVDTNFL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	48	328	3.7e-71	0.9236111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	5.17e-40	40	324	2	276	Pectinesterase.
178372	PLN02773	1.34e-37	41	326	6	282	pectinesterase
178051	PLN02432	5.43e-37	39	328	10	274	putative pectinesterase
215130	PLN02217	9.29e-36	40	324	252	526	probable pectinesterase/pectinesterase inhibitor
178113	PLN02497	1.44e-35	40	335	34	317	probable pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54870.1|CE8	4.40e-211	1	351	1	347
ACO54874.1|CE8	1.14e-204	1	351	1	348
ACO54872.1|CE8|3.1.1.11	1.34e-196	1	351	1	348
ACO54875.1|CE8	1.08e-176	10	351	6	346
ABQ63096.1|CE8	6.22e-164	1	351	1	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	4.10e-58	32	350	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	5.78e-58	32	350	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	3.32e-30	40	324	9	283	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	8.46e-29	41	324	6	279	Chain A, Pectinesterase 1 [Solanum lycopersicum]
4PMH_A	2.43e-13	36	314	32	366	The structure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	8.33e-78	32	350	20	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	1.49e-75	32	351	20	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q4WBT5|PMEA_ASPFU	5.69e-61	32	350	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	5.69e-61	32	350	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	4.46e-60	32	350	28	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000198	0.999793	CS pos: 22-23. Pr: 0.8318

TMHMM  Annotations     

There is no transmembrane helices in PITG_08912-t26_1-p1.