CAZyme Information: PITG_08911-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_08911-t26_1-p1
• CAZy Family: GH28
• CAZyme Description: pectinesterase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
193	DS028133|CGC1	21766.03	5.6632

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028133:1648988-1649614(-)

Full Sequence      

MYNLNVANTAGKIGGKVGQAVAVYANGTDYGFYACNFSGYQDTLCAQSGRELYARTLIRG
ATDFIFGKLAQAWFEKCDIETNPSWYVFNHAHVFTANASLNGSTYLGRPWRPYSRVVFQN
SELGDVIHPQGWKRWNNDTNTDNIYYKEFNNSGPGSAIEQRVPFSGQLNEAVAISDIFGE
NYTSEWWVDNKYL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	1	172	3.2e-52	0.6354166666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	4.25e-43	8	166	98	276	Pectinesterase.
178606	PLN03043	7.65e-37	8	166	324	502	Probable pectinesterase/pectinesterase inhibitor; Provisional
178346	PLN02745	3.54e-36	8	186	383	583	Putative pectinesterase/pectinesterase inhibitor
178051	PLN02432	8.36e-36	15	173	108	277	putative pectinesterase
178113	PLN02497	1.10e-34	20	171	142	309	probable pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54870.1|CE8	1.59e-103	1	193	141	347
ACO54874.1|CE8	1.35e-87	1	193	144	348
ABQ63096.1|CE8	1.74e-87	1	193	140	344
ACO54875.1|CE8	5.10e-87	1	193	140	346
ACO54873.1|CE8	5.68e-86	1	193	140	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	4.84e-41	1	192	103	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	4.84e-41	1	192	103	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1XG2_A	5.21e-25	1	166	94	279	Chain A, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	5.54e-23	3	166	100	283	Pectin methylesterase from Carrot [Daucus carota]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	1.54e-49	1	193	123	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	9.52e-48	1	193	124	331	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|Q4WBT5|PMEA_ASPFU	1.86e-42	1	192	128	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	1.86e-42	1	192	128	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|B8NPS7|PMEA_ASPFN	2.63e-42	1	192	128	324	Probable pectinesterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999732	0.000318

TMHMM  Annotations     

There is no transmembrane helices in PITG_08911-t26_1-p1.