CAZyme Information: PITG_08902-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_08902-t26_1-p1
• CAZy Family: GH28
• CAZyme Description: pleiotropic drug resistance protein, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
901		98733.37	4.6519

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028133:1558831-1565091(+)

Full Sequence      

MVATSGKMPRRTLTAEETRLCKAALSDRHKRRLRRDDERQSAAEPKHGAEGRALKKQSRK
RAVKLTTTAMEIAESRGPHIEPAAPKETEATASTDEAKEVIPVAENEEDSVEPEVEEVVV
DVVMAVASTVASSALLTPVRDAQGAVETLRPPRTNKQAPVTQRSPKRRRRVLQDSPEREA
QAEGTISDTTDTGAASAAPHLPVACVVDGDPNIMAAGARECTGLGSEDSEWEGDWELGEL
SDEELADCVGTELPDTFCKSVAMNAARLAEMKHSGWEYGERRRVTTGEMAFFFVMDRLDD
EISTGLDSATTFDIVWKQRELATKQHKTVVMALLQPAPETAIFLSVGQLSEIPSFMEARE
VFYKQRSANFYHTSSFVIAYLTAAFPVIVCESVVFGSLVYWMCGLGESSDLVCAFSDGAG
KTTLMDVIAGRKTGGSIRGEIMLNGFVATERAIRRCTGYCEQQDTHSEGSTIREALTFSA
LLRQDSSISMDAKRESVEECLDLLGLCLIADQVEQMKRVTIGVELAAQPSVLFLDEPTSG
LDAHSAKMIMDGVRKVANTGRTVVCTIHQPSSDIFFLFDSLLVLKQGGGMVFFGNLVHSL
PDQRECGQLIDYFESIGSSWPVGRPKSSHLDAPMFYQGINSAIGCQILEDAPLSIGRITI
KDCIEQVFNIKHDDVYIHFECLLAYAVLLYMFVPSSKVKVYNLNVANTVGKVEKNGQGVA
IYADGADYGFYACNFTGYQDTVCANKGRELYAKSYISGAVDFVFGQRAMAWFESCDIESI
GEGWITANGNANATVTSEYVFNNARVFGNGSTYLGRPWRPFARVVWQNSELGDIVNPEGW
AAWDESTSTADVYLKEFNNKGPGAAIDQRVAFSGQLDAAVAIKDILGENFESEWWVDTTF
L

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	691	881	7.8e-57	0.6701388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
213199	ABCG_PDR_domain2	8.02e-74	416	594	41	192	Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters. The pleiotropic drug resistance (PDR) is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. This PDR subfamily represents domain I of its (ABC-IM)2 organization. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
273362	3a01205	4.87e-66	418	619	799	1005	Pleiotropic Drug Resistance (PDR) Family protein. [Transport and binding proteins, Other]
215599	PLN03140	2.94e-60	418	616	916	1119	ABC transporter G family member; Provisional
213180	ABCG_EPDR	1.02e-59	418	594	45	194	Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily. ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR). DR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. Compared to other members of the ABC transporter subfamilies, the ABCG transporter family is composed of proteins that have an ATP-binding cassette domain at the N-terminus and a TM (transmembrane) domain at the C-terminus.
273361	3a01204	2.62e-47	403	607	45	262	The Eye Pigment Precursor Transporter (EPP) Family protein. [Transport and binding proteins, Other]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54874.1|CE8	4.16e-107	695	901	139	348
ACO54870.1|CE8	1.03e-102	695	901	136	347
ACO54872.1|CE8|3.1.1.11	2.48e-99	698	901	141	348
ABQ63096.1|CE8	3.33e-98	695	901	135	344
ACO54873.1|CE8	6.54e-98	695	901	135	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7P03_A	7.16e-44	416	618	906	1112	Chain A, Pleiotropic ABC efflux transporter of multiple drugs [Saccharomyces cerevisiae S288C],7P04_A Chain A, Pleiotropic ABC efflux transporter of multiple drugs [Saccharomyces cerevisiae S288C],7P05_A Chain A, Pleiotropic ABC efflux transporter of multiple drugs [Saccharomyces cerevisiae S288C],7P06_A Chain A, Pleiotropic ABC efflux transporter of multiple drugs [Saccharomyces cerevisiae S288C]
5C1E_A	5.05e-36	693	900	96	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	5.05e-36	693	900	96	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
7R8C_A	5.84e-29	397	607	99	312	Chain A, Isoform 4 of ATP-binding cassette sub-family G member 1 [Homo sapiens],7R8C_B Chain B, Isoform 4 of ATP-binding cassette sub-family G member 1 [Homo sapiens]
6ETI_A	7.33e-29	418	617	83	281	Structure of inhibitor-bound ABCG2 [Homo sapiens],6ETI_B Structure of inhibitor-bound ABCG2 [Homo sapiens],6FEQ_A Structure of inhibitor-bound ABCG2 [Homo sapiens],6FEQ_B Structure of inhibitor-bound ABCG2 [Homo sapiens],6HIJ_A Cryo-EM structure of the human ABCG2-MZ29-Fab complex with cholesterol and PE lipids docked [Homo sapiens],6HIJ_B Cryo-EM structure of the human ABCG2-MZ29-Fab complex with cholesterol and PE lipids docked [Homo sapiens],6VXF_A Structure of apo-closed ABCG2 [Homo sapiens],6VXF_B Structure of apo-closed ABCG2 [Homo sapiens],6VXH_A Structure of ABCG2 bound to imatinib [Homo sapiens],6VXH_B Structure of ABCG2 bound to imatinib [Homo sapiens],6VXI_A Structure of ABCG2 bound to mitoxantrone [Homo sapiens],6VXI_B Structure of ABCG2 bound to mitoxantrone [Homo sapiens],6VXJ_A Structure of ABCG2 bound to SN38 [Homo sapiens],6VXJ_B Structure of ABCG2 bound to SN38 [Homo sapiens],7NEQ_A Chain A, ATP-binding cassette sub-family G member 2 [Homo sapiens],7NEQ_B Chain B, ATP-binding cassette sub-family G member 2 [Homo sapiens],7NEZ_A Chain A, ATP-binding cassette sub-family G member 2 [Homo sapiens],7NEZ_B Chain B, ATP-binding cassette sub-family G member 2 [Homo sapiens],7NFD_A Chain A, ATP-binding cassette sub-family G member 2 [Homo sapiens],7NFD_B Chain B, ATP-binding cassette sub-family G member 2 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O81016|AB32G_ARATH	4.72e-50	418	616	866	1069	ABC transporter G family member 32 OS=Arabidopsis thaliana OX=3702 GN=ABCG32 PE=1 SV=1
sp|Q8GU89|AB37G_ORYSJ	1.13e-49	418	642	900	1126	ABC transporter G family member 37 OS=Oryza sativa subsp. japonica OX=39947 GN=ABCG37 PE=2 SV=1
sp|Q7PC86|AB35G_ARATH	4.65e-49	418	615	888	1090	ABC transporter G family member 35 OS=Arabidopsis thaliana OX=3702 GN=ABCG35 PE=2 SV=1
sp|Q8GU86|AB43G_ORYSJ	4.68e-49	418	616	900	1103	ABC transporter G family member 43 OS=Oryza sativa subsp. japonica OX=39947 GN=ABCG43 PE=2 SV=2
sp|Q7FMW4|AB38G_ORYSJ	4.85e-49	418	616	956	1159	ABC transporter G family member 38 OS=Oryza sativa subsp. japonica OX=39947 GN=ABCG38 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000000	0.000030

TMHMM  Annotations     

There is no transmembrane helices in PITG_08902-t26_1-p1.