CAZyme Information: PITG_08892-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_08892-t26_1-p1
• CAZy Family: GH2
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
309		31709.68	4.5553

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028133:1480628-1481557(-)

Full Sequence      

MKIIALVAAGAAILTSIPSVHGHGYIVDPAAQWTQGYPSNGYGSTIDSKVFGEIDGGKYG
YGPNGAINIIKANLATKGGGSLGALIAKNQKLYSSEVDPDCGLTTFKDSARSKLPASQLE
YTGFTHPGPCEVWCDDTKVLFDYDCQTKFPGSPSKIPFDESKCAKANRLTIYWLAVHGEQ
WQVYSDCVWLEGGSGKGEPPSTVGAGASTVAAGSGSSSTQTTTPTPASNASPSTNSTSPS
TSTTNAATNAPATNSDEIGNEASTAGGGETPATEETAPATEETTPSTDEATPATEAPSTS
TTSKCTRRQ

Enzyme Prediction     

No EC number prediction in PITG_08892-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA17	11	276	1.1e-62	0.963265306122449

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
411470	opacity_OapA	0.003	246	304	201	259	opacity-associated protein OapA. This family consists of full-length homologs to OapA, opacity-associated protein A as described in Haemophilus influenzae. OapA shares a C-terminal homology domain, called the OapA domain, with the Escherichia coli protein YtfB, which is now known to bind peptidoglycan through its OapA domain and to act as a cell division protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EEY56114.1|AA17	1.21e-181	1	309	1	309
ETL25321.1|AA17	8.30e-144	1	206	1	206
ETK71888.1|AA17	3.37e-143	1	206	1	206
ETO60224.1|AA17	3.37e-143	1	206	1	206
ETN16020.1|AA17	3.74e-143	1	206	1	206

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Z5Y_A	1.37e-11	23	194	1	174	Chain A, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4],6Z5Y_B Chain B, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4]

Swiss-Prot Hits     

PITG_08892-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000254	0.999743	CS pos: 22-23. Pr: 0.9803

TMHMM  Annotations     

There is no transmembrane helices in PITG_08892-t26_1-p1.