CAZyme Information: PITG_08863-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_08863-t26_1-p1
• CAZy Family: PL3|PL3
• CAZyme Description: pectinesterase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
230	DS028133|CGC5	25363.05	4.4995

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028133:1313265-1314017(-)

Full Sequence      

MSYAANEVTITQAKAQKDIPPEIKDNRNFLTTTLGFKSPSGVKVYSLNVANTAGKIKDLG
QAVAVYVDSTDYGFYACNFTGYQDTLCAHKGRELYARSFISGAVGDGWVTANGNKNATIA
SEYVFNKAHVFGLNESMNGTTHLGRPWGEYARVVFQNSELEDVVNLEGWTPWDDKTSTDN
VYFKEFNNEGPGAVTVARVPYSGQLDAAVDITEILGDDYESQWWVDSKFL

Enzyme Prediction     

EC	3.1.1.11:1	3.1.1.11:1

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	4.16e-34	51	203	98	276	Pectinesterase.
215130	PLN02217	1.92e-29	51	203	348	526	probable pectinesterase/pectinesterase inhibitor
178372	PLN02773	1.30e-27	60	205	120	282	pectinesterase
215357	PLN02665	1.38e-27	47	206	161	341	pectinesterase family protein
215379	PLN02708	7.25e-27	47	207	337	531	Probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54870.1|CE8	1.66e-108	2	230	99	347
ACO54874.1|CE8	4.59e-106	2	230	102	348
ACO54872.1|CE8|3.1.1.11	2.30e-101	2	230	101	348
ACO54875.1|CE8	7.08e-100	1	230	97	346
ABQ63096.1|CE8	5.93e-91	2	230	99	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1E_A	1.81e-29	2	229	68	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.81e-29	2	229	68	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1GQ8_A	7.81e-25	40	203	94	283	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	1.95e-20	41	203	91	279	Chain A, Pectinesterase 1 [Solanum lycopersicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	5.26e-46	2	229	88	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	3.49e-43	2	230	88	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q4WBT5|PMEA_ASPFU	7.79e-35	2	229	93	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	7.79e-35	2	229	93	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	1.16e-33	2	229	93	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000005

TMHMM  Annotations     

There is no transmembrane helices in PITG_08863-t26_1-p1.