CAZyme Information: PITG_08647-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_08647-t26_1-p1
• CAZy Family: GH19
• CAZyme Description: polysaccharide lyase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
180		19397.53	4.8266

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028130:3131825-3132367(-)

Full Sequence      

MQTFDRSDVTCSEGEGQKDTAVFLVEAGGTLKNAIIGKNQKEGVHCDDHDCTIENVWWDD
VCEDALSVKGGTASSVTTVTNCGARSASDKVVQHNGQGTVNIDGFYAEEFGKLYRSCGTC
GDVPRIVTIKNVYAVDPQVSVITVNKNYGDKATLSNIWVKTSDGSNEVKVPGRSQTLKPW

Enzyme Prediction     

EC	4.2.2.2:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	1	162	8.7e-69	0.8350515463917526

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	7.51e-74	1	157	29	181	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADN18841.1|PL3_2	2.67e-82	1	168	51	219
ADN18837.1|PL3_2	2.67e-74	1	160	61	221
ADN18836.1|PL3_2	3.23e-70	1	168	47	216
ADN18840.1|PL3_2	1.90e-69	1	160	61	221
ADN18839.1|PL3_2	1.26e-62	1	160	53	231

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3B90_A	8.05e-23	2	160	12	181	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B90_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
3B4N_A	5.16e-22	2	160	130	299	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B4N_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_A Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
1EE6_A	5.04e-21	2	118	22	135	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4U49_A	9.28e-19	9	171	144	310	Chain A, Pectate lyase [Pectobacterium carotovorum],4U49_B Chain B, Pectate lyase [Pectobacterium carotovorum],4U4B_A Chain A, Pectate lyase [Pectobacterium carotovorum]
4EW9_A	1.75e-15	12	118	38	138	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B024|PLYF_EMENI	1.18e-51	4	157	53	205	Probable pectate lyase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyF PE=3 SV=2
sp|Q5BA88|PLYD_EMENI	3.69e-49	1	156	67	220	Probable pectate lyase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyD PE=3 SV=1
sp|Q0CJ20|PLYG_ASPTN	4.59e-49	1	156	52	203	Probable pectate lyase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyG PE=3 SV=1
sp|Q0CJ49|PLYD_ASPTN	1.54e-48	1	154	59	208	Probable pectate lyase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyD PE=3 SV=1
sp|Q5AY82|PLYG_EMENI	6.88e-48	1	156	63	214	Probable pectate lyase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000002

TMHMM  Annotations     

There is no transmembrane helices in PITG_08647-t26_1-p1.