CAZyme Information: PITG_08646-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_08646-t26_1-p1
• CAZy Family: GH19
• CAZyme Description: polysaccharide lyase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
174		18882.21	5.7184

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028130:3130760-3131358(-)

Full Sequence      

MQTFERSDISCEGQTESGSDTAVFMMEPGATLKNAIIGKNQMEGVHCDKHDCTIDNVWWD
DVCEDALSIKGGTASSVSKVIGGGARSADDKVIQHNGYGTVEIDGFYGEDIRKLYRSCGT
CGDRPKKVSVSNVYIVNPGNAVVTVNKNWGDEATLSNIWVKSSGKKKVKILLRE

Enzyme Prediction     

EC	4.2.2.2:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	1	166	1.2e-72	0.845360824742268

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	1.10e-75	1	158	29	181	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADN18841.1|PL3_2	4.64e-108	1	170	51	219
ADN18837.1|PL3_2	1.24e-85	1	166	61	224
ADN18840.1|PL3_2	1.27e-80	1	166	61	224
ADN18839.1|PL3_2	1.97e-70	1	161	53	231
AHX74070.1|PL3_2	1.97e-70	1	161	53	231

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3B90_A	9.45e-23	3	162	8	182	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B90_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
3B4N_A	5.98e-22	3	162	126	300	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B4N_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_A Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
1EE6_A	5.95e-21	2	119	22	135	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	9.76e-18	2	119	20	138	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	9.96e-18	2	119	21	139	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CJ20|PLYG_ASPTN	2.86e-51	1	157	52	203	Probable pectate lyase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyG PE=3 SV=1
sp|A1DBJ7|PLYE_NEOFI	2.25e-49	1	156	59	211	Probable pectate lyase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyE PE=3 SV=1
sp|Q4WC29|PLYE_ASPFU	4.50e-49	1	156	59	211	Probable pectate lyase E OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyE PE=3 SV=1
sp|B0Y9M8|PLYE_ASPFC	4.50e-49	1	156	59	211	Probable pectate lyase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyE PE=3 SV=1
sp|A1DCY5|PLYD_NEOFI	1.77e-48	9	157	53	198	Probable pectate lyase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000029	0.000018

TMHMM  Annotations     

There is no transmembrane helices in PITG_08646-t26_1-p1.