CAZyme Information: PITG_08612-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_08612-t26_1-p1
• CAZy Family: GH17
• CAZyme Description: cell 5A endo-1,4-betaglucanase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
574		63641.75	5.0160

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028130:2945045-2946833(-)

Full Sequence      

MPRSSSTTPAATDSTDPPSNTFRNSEYTSGRASTYIDQGPGSESGRDTMSLRQTEMKLMA
LEPSDTSTPERVQDYKGRIRTWRGIILLFLIVGGAAAIITACALSENDSAATRQSRYENK
TEERRRINDGLTDDDVIISDDGQVGNPKKYPDMGCELPDYQSKNGQIFAVSKNGTEVPVG
IKGVNWFGMETGLAIPFGLWENMDNGTSVYEVAAFLARNKFNSVRLPVCIKNILKNTAPQ
KSLINVNTNRAINITTYITTLQTIIQALGYRKITVMISLHTLDIKKSGGAWYSDELDVTE
EQFLKAVDILTKNLCTSKYWNILGLDLKNEPHECSWGGAAPDWQKGSTLIGNRMLKGCPN
WMAFVEGIAGSGTVTVGDRTDTYYDWWGGGLQNAGKNPVELTAENKLVWAPHYYNTGVFP
AWYLYESTGDKDESGAFKTYSELGDTTLRRNVEITMDKMFGYLLGVDTNSAMVMGEFAGL
YAKDKHPKKTTKRTTDFTIDVMIQAGYAGGYMWSLNPESAYQFNPADTFGHFTEGLLEDD
WLTPNKVFMEGMAALDDVKDLKMFPCFPQKKASS

Enzyme Prediction     

No EC number prediction in PITG_08612-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	176	519	2.6e-152	0.997093023255814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	8.63e-21	164	569	32	404	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	2.49e-07	211	482	28	241	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABL75352.1|GH5_20	0.0	1	574	9	584
ABC87087.1|GH5_20	0.0	16	574	29	587
ABK59035.1|GH5_20	0.0	16	574	29	587
ABG80550.1|GH5_20	0.0	1	574	9	581
ABG80551.1|GH5_20	0.0	1	574	9	581

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VVG_A	5.58e-40	160	543	8	363	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3W6M_A	7.69e-40	160	543	8	363	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
2ZUM_A	2.59e-39	160	543	41	396	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3AXX_A	3.55e-39	160	543	41	396	Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_B Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_C Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3QHO_A	1.26e-38	160	543	41	396	Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_B Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_C Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P19487|GUNA_XANCP	5.76e-30	179	541	42	354	Major extracellular endoglucanase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=engXCA PE=1 SV=2
sp|P54583|GUN1_ACIC1	7.54e-28	177	547	60	383	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P10474|GUNB_CALSA	1.19e-19	170	425	638	902	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000015

TMHMM  Annotations     

Start	End
82	104