CAZyme Information: PITG_08564-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_08564-t26_1-p1
• CAZy Family: GH17
• CAZyme Description: pectin lyase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382		40271.50	9.9995

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028130:2771612-2772897(+)

Full Sequence      

MQILRFVVVAIAALAMQGTQALPMGSGNTVQQSQVDQTQQQSSTKQGKTSSSSKISTGKA
PGLAAGTTGGGNATPVYPNSLADLKNYLQDSQPRVIVLTKTFDFRGTEGTRTETGCRPKS
NRDCLAKNNGYKGQDVILQSGGMQNTGGCVQGTAIKVTYDLAGTKNPLLVTDNKTLRGVG
ASGVIKGKGLWIRGNNVIIQNIHITELNPHLIWGGDVIYIQGLNGGKTPMERVWLDHVKI
SNLGRPMIATGSASVKSATVGGSSVIHAANNYWYSNSGFSYDVVENGNVLLEGNYFESTA
VPSKNDTETVGAIIVPSSSTQTKCKSTLGRNCVENTVVKCGSLSGSRESAVLTNSKKVAP
YYQPIAAKRFSSTSQNFGVGPI

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	156	262	9.9e-36	0.5294117647058824

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	3.53e-17	156	299	1	144	Amb_all domain.
226384	PelB	1.14e-07	130	246	51	169	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	0.004	165	296	27	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR19252.1|PL1_4	6.70e-223	1	382	1	432
ACR19249.1|PL1_4	3.87e-215	1	382	1	432
AHX74067.1|PL1_4	3.87e-215	1	382	1	432
ACR19255.1|PL1_4	2.53e-189	1	380	1	396
ACR19247.1|PL1_4|4.2.2.10	4.16e-188	1	380	1	396

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	3.06e-50	58	344	5	322	Pectin Lyase A [Aspergillus niger]
1QCX_A	1.65e-49	58	380	5	358	Pectin Lyase B [Aspergillus niger]
1IDJ_A	7.14e-47	58	335	5	313	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8NJK6|PELF_ASPNG	2.10e-61	57	382	25	383	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	2.10e-61	57	382	25	383	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|Q0CZD4|PELF2_ASPTN	1.50e-57	58	346	25	344	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|Q5BA61|PELB_EMENI	1.71e-55	57	382	23	379	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1
sp|B8N316|PELF_ASPFN	2.02e-55	62	351	29	351	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000194	0.999785	CS pos: 21-22. Pr: 0.9777

TMHMM  Annotations     

There is no transmembrane helices in PITG_08564-t26_1-p1.