CAZyme Information: PITG_08563-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_08563-t26_1-p1
• CAZy Family: GH17
• CAZyme Description: pectin lyase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
316		34107.14	9.5501

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028130:2761946-2763172(+)

Full Sequence      

MQIFRVVIVAIAAFAMQGSHALSTGIAPGLAAGTTGGGNANPVYPTSLAELKNYLKDSQP
RVIVLRTTFDFRGTEGTTTENGCRPKSNRDCLAKNNGHKGQDVILQSGGMANTGGHRADN
VIIQNVHITQLNPHLIWGGDAIYIQGLNSGKTAMQRVWIDHVKISNIGRQMVATNTASVK
GLIISNCEFDGQTQYSATCDGNHYWTFLFLGTQTQASLVNNFVHHTSGRSPKVGGSSVVH
AANNYWYSNSGFSYDVVENGNVLLEGNYFESTTTLRRRDSAALTNTKKTASYYHPTSPQK
LSTNSQNYGVGILSSK

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	116	270	2.2e-62	0.7967914438502673

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	2.05e-20	117	272	38	189	Amb_all domain.
366158	Pec_lyase_C	3.68e-07	120	269	61	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.
226384	PelB	5.68e-07	39	270	53	274	Pectate lyase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR19251.1|PL1_4	1.90e-183	1	314	1	399
ACR19247.1|PL1_4|4.2.2.10	2.69e-183	1	314	1	399
ACR19255.1|PL1_4	1.55e-182	1	314	1	399
ACR19252.1|PL1_4	1.15e-156	1	313	1	432
AHX74067.1|PL1_4	3.43e-146	1	313	1	432

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	1.36e-54	24	275	4	282	Pectin Lyase A [Aspergillus niger]
1IDJ_A	8.18e-53	24	290	4	298	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1QCX_A	1.91e-50	25	270	5	277	Pectin Lyase B [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CZD4|PELF2_ASPTN	3.37e-65	1	274	1	301	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|Q5BA61|PELB_EMENI	2.28e-64	8	275	7	301	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1
sp|B8N316|PELF_ASPFN	1.61e-63	29	274	29	302	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|Q2UJA7|PELF_ASPOR	1.61e-63	29	274	29	302	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2
sp|Q0CYL8|PELA_ASPTN	3.46e-63	4	293	3	324	Probable pectin lyase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000188	0.999782	CS pos: 21-22. Pr: 0.9808

TMHMM  Annotations     

There is no transmembrane helices in PITG_08563-t26_1-p1.