CAZyme Information: PITG_08558-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_08558-t26_1-p1
• CAZy Family: GH17
• CAZyme Description: pectin lyase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
778		81601.74	5.2091

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028130:2725996-2728566(+)

Full Sequence      

MALAQTLVASAGPVVSGTPPGFAAGTTGGGNAEPVYPKDIKELSTYLSDDEPRVIVLKQE
FNFMESEGITTEDGCHAKGAADCAAKKNGFEPQDTIQPSFTTCDNIMVKVTYDKAAKTPL
KVASNKTLVGEGTSGVLTGKGIEIKGNNVIVQNIHITDLNPQYVWGGDAIGISGDNGVIP
TGIWLDHVKVTSVGRQMIVIHLSGALGVTISNSDFDGKTKYSSSCDGHHYWGFIITGAKT
EVTLVGNAIHGMSGRSPKIGGSKDNVIAVHAVNNYFYDNSGHAFDVSQRGYVLAEGNYFD
NVKTPNQPDPDGNIFILASAGDCKETIGRDCELNALTDSGTLTSNKEEESKKPISTYTTQ
IEEYKASAATKLAVASDNFGVGELGGNSVTQSSGSEAPSQGTPAPATPESPSIQGSPANG
ALSPEDPKHTGLSTSTSTSSSVIGAPIGFASGTIGGGSAEPVYPKDIKKLGTYLSDKEPR
VIVLKQEFKFIDSEGSTTEKGCHSKNNMDCIAKKNGFEGQDTIETDFSKCDGASIDVTYD
NAAITPLPITSDKTLIGEGTKGVLNGKGILVKGSNVIIQNIHITNLNSHLVWGGDAIGIS
GDGNNAPKGIWIDHVKVSSIGRQMVVTHFSGASGATISNSDFHGNTKYSQSCDGRHYWGF
LILGKKTEMSLLGNYIHMTSGRSPKIGGTEGDVSVVHAANNYFEDNTGHAFDVVTGGSVL
AEGNNFDSVKTPNQPDPAGNIFIPASAGDCKATIGRDCEVNVLADSGSFTNRRELWCW

Enzyme Prediction     

EC	4.2.2.10:1	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	109	301	1.9e-79	0.9946524064171123
PL1	537	727	6.2e-77	0.983957219251337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	1.15e-37	109	303	1	190	Amb_all domain.
214765	Amb_all	4.16e-32	536	730	1	190	Amb_all domain.
226384	PelB	3.96e-17	114	305	91	279	Pectate lyase [Carbohydrate transport and metabolism].
226384	PelB	3.01e-15	534	727	84	274	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	3.53e-14	113	299	23	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR19250.1|PL1_4	1.03e-210	356	774	3	524
ACR19256.1|PL1_4	1.51e-163	442	756	32	346
ACR19253.2|PL1_4	2.82e-161	3	479	14	534
ACR19257.1|PL1_4	2.56e-113	16	281	22	296
ACR19255.1|PL1_4	6.21e-113	16	384	24	398

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	1.34e-84	15	345	3	325	Pectin Lyase B [Aspergillus niger]
1IDJ_A	1.48e-82	15	345	3	324	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1IDK_A	2.07e-82	15	345	3	324	Pectin Lyase A [Aspergillus niger]
1PCL_A	1.45e-11	113	314	69	293	Chain A, PECTATE LYASE E [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CZD4|PELF2_ASPTN	2.79e-93	15	344	23	343	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|Q5BA61|PELB_EMENI	1.21e-90	15	342	22	341	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1
sp|Q2UJA7|PELF_ASPOR	4.08e-89	441	774	22	348	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2
sp|B8N316|PELF_ASPFN	4.08e-89	441	774	22	348	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|A1CFS2|PELA_ASPCL	9.46e-89	1	340	7	338	Probable pectin lyase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=pelA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.894193	0.105824

TMHMM  Annotations     

There is no transmembrane helices in PITG_08558-t26_1-p1.