CAZyme Information: PITG_07680-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_07680-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: pectin lyase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303		32530.05	8.2469

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028128:2834412-2835323(+)

Full Sequence      

MGHLRLAIAAALAVVVKSVSAFTIGSPPGFAAGTAGGADGTVVYPNTNEELIAYLNAPEP
LVLVLNNTFDFRGTEGATTEIGCRPQSARECIPANSGFKSQDVILTNGMNNTGGCKNGTE
TIVAYDNAYRWRMKVTSHKTICGIGRRGVIMGKGMTLKGDNIIVQNIHITELNRHLVWGG
DALFMEGTINGTKTMNNIWIDHVKVSRVGRQMLIVSKAGVASLTVSNSDFDGEIDYSASC
NGRHYWTILLYGKEVGVSLLDNYVHSTSGRSLKIGDKNSSVIAHVANNYFSNLDNHLMGM
RGC

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	123	299	2.3e-64	0.9037433155080213

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	2.40e-19	122	302	3	175	Amb_all domain.
226384	PelB	1.92e-07	133	292	97	250	Pectate lyase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHX74069.1|PL1_4	4.35e-138	1	296	1	298
ADN18835.1|PL1_4	1.76e-137	1	296	1	298
ADN18834.1|PL1_4	1.14e-123	1	296	1	298
AHX74068.1|PL1_4	3.26e-123	1	296	1	298
ACR19258.1|PL1_4	2.27e-122	1	296	1	297

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	1.07e-56	24	296	4	259	Pectin Lyase B [Aspergillus niger]
1IDJ_A	2.55e-54	25	296	5	259	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1IDK_A	1.98e-53	25	296	5	259	Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UJA7|PELF_ASPOR	7.49e-64	24	296	24	280	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2
sp|B8N316|PELF_ASPFN	7.49e-64	24	296	24	280	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|Q0CZD4|PELF2_ASPTN	9.37e-64	24	296	24	279	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	4.69e-63	25	296	26	281	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|Q8NJK6|PELF_ASPNG	4.69e-63	25	296	26	281	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000229	0.999748	CS pos: 21-22. Pr: 0.9799

TMHMM  Annotations     

There is no transmembrane helices in PITG_07680-t26_1-p1.