CAZyme Information: PITG_06685-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_06685-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: putative alpha 1,3-fucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
242		27295.19	8.3229

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028125:3731469-3732197(-)

Full Sequence      

MLSGEAWGTDGLDERILLISTLATTNRTRHVYLPMASISFAERLDHGPLSLLSSAASKRG
MIKQKFCAYLYARCEHSSRELMYDLLNARRPVEALGKCAGSSRPPDFTKLVSRQAMFYND
DAVRRYAPYKFVIAFENTRSPGYVTEKLVNAFLAGSVPIYLGDSATVSQLFNPASFIDCG
RFDSLQLCAEYVLQLDDSPELYNRMRQERPVTNKTSFNLAFSWHPALSNRFMADVMLQHF
SA

Enzyme Prediction     

No EC number prediction in PITG_06685-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT10	23	209	1.5e-39	0.5072046109510087

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395683	Glyco_transf_10	1.83e-23	63	204	1	132	Glycosyltransferase family 10 (fucosyltransferase) C-term. This is the C-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The C-terminal domain is the likely binding-region for ADP (manuscript in publication).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS83483.1|GT10|GT25	1.22e-24	17	208	388	586
QQR32886.1|GT10	1.89e-21	56	202	123	258
ANU61948.1|GT10	1.89e-21	56	202	123	258
ASB35439.1|GT10	1.89e-21	56	202	123	258
AEJ34901.1|GT10	2.37e-21	63	219	68	220

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NZW_A	2.29e-14	62	211	178	313	Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_C Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZX_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZY_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori]
5ZOI_A	4.12e-13	62	211	178	313	Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],5ZOI_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5UQ63|YR654_MIMIV	7.16e-21	63	219	423	575	Putative fucosyltransferase R654 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R654 PE=3 SV=1
sp|Q9VLC1|FUCTB_DROME	1.08e-13	24	214	128	325	Alpha-(1,3)-fucosyltransferase B OS=Drosophila melanogaster OX=7227 GN=FucTB PE=2 SV=2
sp|O30511|FUCT_HELPX	1.54e-13	62	211	178	313	Alpha-(1,3)-fucosyltransferase FucT OS=Helicobacter pylori OX=210 GN=fucT PE=1 SV=1
sp|Q9C8W3|FUT13_ARATH	3.72e-12	72	203	222	358	Alpha-(1,4)-fucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=FUT13 PE=2 SV=2
sp|Q11127|FUT4_MOUSE	3.26e-11	48	204	246	387	Alpha-(1,3)-fucosyltransferase 4 OS=Mus musculus OX=10090 GN=Fut4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999986	0.000054

TMHMM  Annotations     

There is no transmembrane helices in PITG_06685-t26_1-p1.