CAZyme Information: PITG_06606-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_06606-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: UDP-N-acetylglucosamine-peptide N-acetylglucosaminyltransferase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
482	DS028125|CGC6	54336.10	7.4600

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028125:3167237-3169109(+)

Full Sequence      

MAMGNVGVAYELTKDIVSALSWYERALHEIVSSPDTVYPDGLTAQMSFMHLMVHIVRAKL
SACVWANAEDEFSLLWTMVTTLQTATDARYAFTPFDSLLHAMSPLDRRSVALTSLNVGYL
SYDFSDHPTTHLMEGIFATRERGSIKTVAFGYGRDDGSAVRQRVIDKVDRFFDLSTASFE
ESAKMIRAEHIHILMDAQGHTRGGRMQIAAARPAPIVVNYLVYPGTSGAPFVDYVIVDKY
VVPPAELATAFTEKLVILPNCYQVNYYDQILASSETISRRSDLWDIAKHEGGDEGFVFVN
FNKIDKLKASLFSTWMSTLRRVPRSSLLLLDPGRNELGDDVTESVTSREIKKNLWKEAQA
QGISRGRVRFVSRIPKAEHLLRHHVGGLFLDTFIYGAHSTATDALYAGLPVITLAGDSFA
RYMYLAMTPSVLSRLQRRLRSDKAELEQPLFRTKQHTQHLEQSQRLMYEVYSLTNRTFHL
VV

Enzyme Prediction     

No EC number prediction in PITG_06606-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	2	428	1.4e-74	0.4099290780141844

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226428	Spy	3.96e-69	115	471	260	618	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
404688	Glyco_transf_41	1.61e-50	49	460	11	543	Glycosyl transferase family 41. This family of glycosyltransferases includes O-linked beta-N-acetylglucosamine (O-GlcNAc) transferase, an enzyme which catalyzes the addition of O-GlcNAc to serine and threonine residues. In addition to its function as an O-GlcNAc transferase, human OGT also appears to proteolytically cleave the epigenetic cell-cycle regulator HCF-1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAG05864.1|GT41	1.59e-82	59	472	180	619
AKV67557.1|GT41	1.06e-79	59	472	587	1026
BBH40672.1|GT41	3.86e-79	59	472	587	1026
BCU13822.1|GT41	1.25e-78	59	472	607	1046
QHU86126.1|GT41	7.08e-78	59	472	587	1026

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JLB_A	2.05e-42	6	420	97	488	Xanthomonas campestris putative OGT (XCC0866), complex with UDP- GlcNAc phosphonate analogue [Xanthomonas campestris pv. campestris],2JLB_B Xanthomonas campestris putative OGT (XCC0866), complex with UDP- GlcNAc phosphonate analogue [Xanthomonas campestris pv. campestris],2VSY_A Xanthomonas campestris putative OGT (XCC0866), apostructure [Xanthomonas campestris pv. campestris str. ATCC 33913],2VSY_B Xanthomonas campestris putative OGT (XCC0866), apostructure [Xanthomonas campestris pv. campestris str. ATCC 33913],2XGM_A Substrate and product analogues as human O-GlcNAc transferase inhibitors. [Xanthomonas campestris],2XGM_B Substrate and product analogues as human O-GlcNAc transferase inhibitors. [Xanthomonas campestris],2XGO_A XcOGT in complex with UDP-S-GlcNAc [Xanthomonas campestris],2XGO_B XcOGT in complex with UDP-S-GlcNAc [Xanthomonas campestris],2XGS_A XcOGT in complex with C-UDP [Xanthomonas campestris],2XGS_B XcOGT in complex with C-UDP [Xanthomonas campestris]
2VSN_A	3.88e-42	6	420	97	488	Structure and topological arrangement of an O-GlcNAc transferase homolog: insight into molecular control of intracellular glycosylation [Xanthomonas campestris pv. campestris str. 8004],2VSN_B Structure and topological arrangement of an O-GlcNAc transferase homolog: insight into molecular control of intracellular glycosylation [Xanthomonas campestris pv. campestris str. 8004]
5A01_A	8.15e-38	49	471	166	698	O-GlcNAc transferase from Drososphila melanogaster [Drosophila melanogaster],5A01_B O-GlcNAc transferase from Drososphila melanogaster [Drosophila melanogaster],5A01_C O-GlcNAc transferase from Drososphila melanogaster [Drosophila melanogaster]
6Q4M_A	1.59e-37	49	481	168	719	Crystal structure of the O-GlcNAc transferase Asn648Tyr mutation [Homo sapiens]
5NPR_A	2.10e-37	49	481	162	713	The human O-GlcNAc transferase in complex with a thiol-linked bisubstrate inhibitor [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Y0|SEC_ARATH	3.90e-51	88	420	568	879	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana OX=3702 GN=SEC PE=1 SV=1
sp|Q8CGY8|OGT1_MOUSE	1.06e-36	49	481	486	1037	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus OX=10090 GN=Ogt PE=1 SV=2
sp|P81436|OGT1_RABIT	1.42e-36	49	481	486	1037	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus OX=9986 GN=OGT PE=1 SV=2
sp|Q27HV0|OGT1_PIG	1.91e-36	49	481	486	1037	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa OX=9823 GN=OGT PE=2 SV=1
sp|O15294|OGT1_HUMAN	1.91e-36	49	481	486	1037	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PITG_06606-t26_1-p1.