CAZyme Information: PITG_06476-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_06476-t26_1-p1
• CAZy Family: GH140
• CAZyme Description: carbohydrate-binding protein, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378		39736.30	4.0960

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028125:2306500-2307712(+)

Full Sequence      

MVRSPPRYYEDASETSACYYPPDNMGPYLSSSYNQRTAPKKKERSKLMRRLVPLLCGLLV
LGIVIVIVAVTLSSDSDDASNTDSGGNSTSASSTLPSSCSPVDSKDRTVAFWQSEVAGCD
TVPDGVTHVVFGFALVADGVIVPTFQTSDATITQCVEKLRERCILTMGSIGGSTNNDNMS
AVANATLFAESAAALMTKFGFDGLDLDDETVGSQFSANRTVGLLKATREALDATGSTSAL
LTYDAYFYEGDASVCSAEETAAYSRCFPSGVLDYVDWVNIMAYNVNLDNATAAAIYAAAV
STTFAAWGTQLGGNFSLATIGLCVGGGCAYGPGPNTTVIAEWETFSRQEGYGGMMIYSAS
AEVADDYPATRSIVSATA

Enzyme Prediction     

EC	3.2.1.14:12	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	117	307	4.6e-20	0.5236486486486487

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119349	GH18_chitinase-like	6.29e-21	123	360	21	208	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
214753	Glyco_18	8.80e-18	123	283	23	184	Glyco_18 domain.
395573	Glyco_hydro_18	1.47e-16	123	284	20	176	Glycosyl hydrolases family 18.
119365	GH18_chitinase	1.82e-15	120	283	20	209	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119351	GH18_chitolectin_chitotriosidase	1.79e-11	127	283	29	188	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA16179.1|CBM50|GH18	2.23e-09	158	283	114	236
CAK44246.1|GH18|3.2.1.14	1.49e-08	120	284	42	222
QRC90751.1|GH18	3.39e-08	156	284	86	212
BCR93532.1|GH18	3.53e-08	120	284	42	222
BCS06167.1|GH18	3.79e-08	120	284	74	254

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IGY_A	6.59e-08	124	284	40	218	Crystal structure of Aspergillus niger chitinase B [Aspergillus niger]
1D2K_A	1.49e-07	158	284	81	205	Chain A, CHITINASE 1 [Coccidioides immitis],1LL4_A Chain A, Chitinase 1 [Coccidioides immitis],1LL4_B Chain B, Chitinase 1 [Coccidioides immitis],1LL4_C Chain C, Chitinase 1 [Coccidioides immitis],1LL4_D Chain D, Chitinase 1 [Coccidioides immitis]
1LL7_A	3.50e-07	158	284	81	205	Chain A, CHITINASE 1 [Coccidioides immitis],1LL7_B Chain B, CHITINASE 1 [Coccidioides immitis]
1LL6_A	6.19e-07	158	284	81	205	Chain A, CHITINASE 1 [Coccidioides immitis],1LL6_B Chain B, CHITINASE 1 [Coccidioides immitis],1LL6_C Chain C, CHITINASE 1 [Coccidioides immitis],1LL6_D Chain D, CHITINASE 1 [Coccidioides immitis]
6KST_A	7.66e-06	126	286	33	203	Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14456|CHI1_METAN	8.52e-09	155	284	109	241	Endochitinase 1 OS=Metarhizium anisopliae OX=5530 GN=chit1 PE=1 SV=1
sp|E9ERT9|CHI1_METRA	3.57e-08	155	284	109	241	Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chit1 PE=3 SV=1
sp|C5P230|CHI1_COCP7	8.24e-07	158	284	116	240	Endochitinase 1 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS1 PE=3 SV=1
sp|P0CB51|CHI1_COCPS	8.24e-07	158	284	116	240	Endochitinase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CTS1 PE=1 SV=1
sp|Q1E3R8|CHI1_COCIM	8.24e-07	90	284	18	240	Endochitinase 1 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999801	0.000248

TMHMM  Annotations     

Start	End
51	73