CAZyme Information: PITG_06279-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_06279-t26_1-p1
• CAZy Family: GH131
• CAZyme Description: putative alpha mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374		42684.72	6.4100

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028125:761099-762223(-)

Full Sequence      

MCRSITQKLRTRVQQQFHNLEVSGSIGPAFLELWRHNLFVADEDASPLIVGYTTESSYAS
VVFECVFKTKFERHNRPILVVPEIVLRLHYANTPDVFIFSVFDADCEPIANSGCAEMIAY
YIQEYHEQSKLMMISGEAINTKDLDERVSLLSSVSSVSRRQHVYLPVVSISFAERLQNSP
IELLSPVATSLIEPSERRFCAYLYARCDRLNREYMFDLLNAMEPVDALGMCAGSLRPPDK
SYKPSRYSKWFNDEAVMSYKRYKFVVAFENSAEPGYVTEKLVNPLLAGSIPVYSGNSTTA
SQLFNPGSFIDCGRFENLENCASFVLQVHKSPELYDRIRREPPIRNITLFNEVFSWHPSI
SSRDLTDKVAKMLH

Enzyme Prediction     

No EC number prediction in PITG_06279-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT10	149	338	6.6e-35	0.5129682997118156

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395683	Glyco_transf_10	8.09e-16	224	335	30	130	Glycosyltransferase family 10 (fucosyltransferase) C-term. This is the C-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The C-terminal domain is the likely binding-region for ADP (manuscript in publication).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPW18992.1|GT10	1.23e-19	188	342	117	267
AEJ34901.1|GT10	8.50e-19	189	342	62	211
QQR32886.1|GT10	9.39e-19	195	342	124	265
ANU61948.1|GT10	9.39e-19	195	342	124	265
ASB35439.1|GT10	9.39e-19	195	342	124	265

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NZW_A	5.44e-13	184	347	167	316	Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_C Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZX_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZY_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori]
5ZOI_A	3.79e-12	184	347	167	316	Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],5ZOI_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5UQ63|YR654_MIMIV	2.32e-18	189	342	417	566	Putative fucosyltransferase R654 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R654 PE=3 SV=1
sp|O30511|FUCT_HELPX	3.98e-12	184	347	167	316	Alpha-(1,3)-fucosyltransferase FucT OS=Helicobacter pylori OX=210 GN=fucT PE=1 SV=1
sp|Q9VLC1|FUCTB_DROME	6.55e-12	202	353	175	331	Alpha-(1,3)-fucosyltransferase B OS=Drosophila melanogaster OX=7227 GN=FucTB PE=2 SV=2
sp|Q68FV3|FUT11_RAT	4.08e-10	202	335	214	348	Alpha-(1,3)-fucosyltransferase 11 OS=Rattus norvegicus OX=10116 GN=Fut11 PE=2 SV=1
sp|Q6NTZ6|FUT10_XENLA	5.21e-10	43	335	68	337	Alpha-(1,3)-fucosyltransferase 10 OS=Xenopus laevis OX=8355 GN=fut10 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000076	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PITG_06279-t26_1-p1.