CAZyme Information: PITG_05271-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_05271-t26_1-p1
• CAZy Family: GH12
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
278		29259.10	4.6509

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028124:2064537-2065496(-)

Full Sequence      

MLSAAAFASTAVLLAASIPSTDAHGYMLIPESQFKGSANSAWIVQIDPVWASEDWDGNKP
GSVNAFKALKTANKFKDLKTLMDDTSVYGADCGFTDPNGKAQPIPKDGKATFSRALVHVG
PCEIWLDDTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGK
TVWQSYKDCIPLEGSGGGGTSQHGDSPSSGKSDSPSSGKSDSPSSGKSDTPSSGDSPTPA
PASGDSPNQGSAPETPSAETPEVSPAPSSKCNGRKRRN

Enzyme Prediction     

EC	1.14.99.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA17	12	258	8.7e-65	0.9591836734693877

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
289042	MSA-2c	0.001	228	273	151	201	Merozoite surface antigen 2c. This family of proteins is found in eukaryotes. Proteins in this family are typically between 263 and 318 amino acids in length. There is a conserved SFT sequence motif. MSA-2 is a plasma membrane glycoprotein which can be found in Babesia bovis species.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EEY69088.1|AA17	2.17e-164	1	278	1	278
ETL27075.1|AA17	8.35e-145	1	277	1	293
ETI31959.1|AA17	8.35e-145	1	277	1	293
AHO49057.1|AA17	1.38e-143	1	211	1	211
EGZ07203.1|AA17	1.30e-134	1	278	1	284

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Z5Y_A	1.10e-63	24	194	1	172	Chain A, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4],6Z5Y_B Chain B, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4]

Swiss-Prot Hits     

PITG_05271-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000595	0.999366	CS pos: 23-24. Pr: 0.9719

TMHMM  Annotations     

There is no transmembrane helices in PITG_05271-t26_1-p1.