CAZyme Information: PITG_05011-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_05011-t26_1-p1
• CAZy Family: GH109
• CAZyme Description: 5A endo-1,4-betaglucanase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542		58831.65	4.5008

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028123:4257770-4259465(+)

Full Sequence      

MSTSGRPSGVGRGSFSAGRSSEVERIIAAADVDTTFAGKKARYRGRRSTWPGALALFLIA
VVSIAGLTYFGIKVHDDVNETVASNEASEESRYTDGTQIEDGSPTDTASDLATTNPKTYT
DRKCEQPNYVSKNGRIFAQLADGTSTQIDIKGINWKGMEDAKGVPKGLWDNMVDGDSLYR
YGYFLKYNKFNVVRFPLSIDAVMRNTDIDTNLINTNSNRALGTASRYNTLLGLLVQGLGQ
FNIGVVLDFHVLSSSDDDSSGLWYGSSIQLADIKTAISNLAEAMCDSTHFNIIGIDLKDG
LSRDATWGDGSDTDWAVAATELGNHMLKECPKWLAFVQGVQGESHKDTYGDRSLKNTFLP
GSDLTGLSTDPITLKTNNKVVYAPKYYTSSYLPRLFFFEDGATSGDLLEDYVEYSDADLL
ANVKTNMNYSFGAAFDTGMAVVLSSFGGLVGDLDATAKQTSTRVIKDVISMMAGSTEPFL
AGGFWWTLNPDTTWPYPAPDDTNATAQGLVDDTWRVANMDVLEVLASMNKTMGSVKFIPC
ST

Enzyme Prediction     

No EC number prediction in PITG_05011-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	147	492	8.2e-130	0.9912790697674418

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	4.55e-05	142	350	39	243	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ25210.1|GH5_20	0.0	1	542	1	542
CCA23923.1|GH5_20	4.07e-185	2	540	4	535
CCD28218.1|GH5_20	9.03e-167	265	541	3	279
ABC87090.1|GH5_20	1.59e-104	19	540	112	627
ABK59037.1|GH5_20	1.59e-104	19	540	112	627

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QHM_A	3.53e-20	140	542	53	426	Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHM_B Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHM_C Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]
2ZUM_A	4.72e-20	140	542	53	426	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3AXX_A	4.72e-20	140	542	53	426	Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_B Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_C Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3QHN_A	4.72e-20	140	542	53	426	Crystal analysis of the complex structure, E201A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHN_B Crystal analysis of the complex structure, E201A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHN_C Crystal analysis of the complex structure, E201A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]
3W6M_A	7.70e-20	140	514	20	361	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P19487|GUNA_XANCP	5.01e-17	128	534	25	374	Major extracellular endoglucanase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=engXCA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999783	0.000218

TMHMM  Annotations     

Start	End
50	72