CAZyme Information: PITG_04949-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_04949-t26_1-p1
• CAZy Family: GH105
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
337	DS028123|CGC1	35713.99	4.4041

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028123:3773553-3774566(-)

Full Sequence      

MVSTTSILAIAAAVATTIDYVQAHGYIAKPAPSWKASKTNNWVVEIEPQWKGGWDESKGD
EGLLATFKELAPKNNFKDVRSLMDGNPVFGEECGFTDPKGKPSEPPSDGTATFSRGIVHA
GPCEIWLDDKMVLQNDDCQSAYGDGTQQTIAVFKPVDYSSCAAGGCMLRFYWLALQRLKG
KTVWQAYKNCIPLTGPAGGGASQQDPATGGGSDTSQKNPDEDPSQQDPATGGGSDTSQKN
PDEDPSQTSPSTGDSSKKEDSDKEEGSDKKEDSDKMEGGSKSDTPSGGEQQTPEAPSNPA
PETPSNSAPETPPADTPEMAPAPAPSSKCNGRRRRRY

Enzyme Prediction     

EC	1.14.99.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA17	11	260	6e-68	0.9591836734693877

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
237284	PRK13108	4.72e-08	194	337	315	453	prolipoprotein diacylglyceryl transferase; Reviewed
236090	PRK07764	7.68e-06	189	328	585	730	DNA polymerase III subunits gamma and tau; Validated
223039	PHA03307	5.31e-05	198	337	257	392	transcriptional regulator ICP4; Provisional
380146	MSCRAMM_SdrC	2.18e-04	202	312	798	909	MSCRAMM family adhesin SdrC. Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.
411231	MSCRAMM_ClfA	2.63e-04	202	307	561	668	MSCRAMM family adhesin clumping factor ClfA. Clumping factor A is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). It is heavily studied in Staphylococcus aureus both for its biological role in adhesion and for its potential for vaccination. Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EEY68486.1|AA17|1.14.99.-	4.75e-179	1	337	1	337
ETI38760.1|AA17	5.74e-154	1	224	1	224
ETK78975.1|AA17	2.33e-153	1	224	1	224
EGZ23516.1|AA17	5.18e-139	1	212	1	212
EGZ23522.1|AA17	3.61e-111	1	219	1	220

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Z5Y_A	2.74e-132	24	195	1	172	Chain A, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4],6Z5Y_B Chain B, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4]

Swiss-Prot Hits     

PITG_04949-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.005254	0.994719	CS pos: 23-24. Pr: 0.8893

TMHMM  Annotations     

There is no transmembrane helices in PITG_04949-t26_1-p1.