CAZyme Information: PITG_04419-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_04419-t26_1-p1
• CAZy Family: GH1
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357	DS028122|CGC5	40852.48	5.2929

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028122:3859594-3860730(+)

Full Sequence      

MHNSAVPMGLSLIRELRCLGNQELIQVYHCFPDEMSEKNRAMLLEADARVEIVDVCAKFV
DQGVMKRETADKFRNWWLKPLALFYTDIKEVLLMDVDDVFLRDPAVLRTTEGYQRTGTTF
FYDRVLLSNEWFNQEVKNSTYLKTLLNDYAYRGEASHEQDSSLVAVDKSRAGQAMTVMFW
LVTVQRFEREFSFGDKETFWIAYALAKHEYFFSPWGPSVIESSRNEDMKKHSDSLCGSLA
HFMPVKDDTPELLYVNGKALLDPFPEGLENRGKASANVLYNPTPSNITPRQNRRPNGGTS
TSYNGEFPMECLIGFGATPLPGNFAPQLLRRRMFYLGIRMDVLSVLDSCYGFDTAAY

Enzyme Prediction     

No EC number prediction in PITG_04419-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	3	237	4.1e-42	0.9356060606060606

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	1.19e-23	8	242	15	272	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA15193.1|GT71	3.52e-106	1	349	138	515
CCA22801.1|GT71	8.98e-104	6	350	70	431
BAP68847.1|GT71	8.75e-94	1	280	72	368
AIG56397.1|GT71	1.59e-65	1	356	98	475
AIG56246.1|GT71	1.05e-55	1	331	71	447

PDB Hits     

PITG_04419-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P53745|MNT4_YEAST	2.96e-09	10	257	213	482	Probable alpha-1,3-mannosyltransferase MNT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNT4 PE=3 SV=1
sp|Q5AGA0|MNN1_CANAL	4.53e-09	3	256	366	663	Putative alpha-1,3-mannosyltransferase MNN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN1 PE=2 SV=1
sp|P39106|MNN1_YEAST	1.01e-07	7	257	330	624	Alpha-1,3-mannosyltransferase MNN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN1 PE=1 SV=1
sp|P53059|MNT2_YEAST	8.29e-06	10	257	190	460	Alpha-1,3-mannosyltransferase MNT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNT2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000037	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PITG_04419-t26_1-p1.