CAZyme Information: PITG_04135-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_04135-t26_1-p1
• CAZy Family: GH1
• CAZyme Description: glycoside hydrolase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
287	DS028122|CGC1	31391.33	6.9527

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028122:1272673-1273536(+)

Full Sequence      

MVAWQSLAVIAAASTLAIGADARKLPSGVCYAPWHHHNVNWGVLAGDMAQVSQHFSSIRT
YQAQFSGVNAITMAAAAGLHIAVGVQLTDPRWIDSEIQAVCDGYAKNSWAVEAVYVGNED
LRNGNFGKYSADQIAGYIRRVKSCVGNTPVGSAQRINEWLGADSAWTLANACDVIGVNIH
PFFTPGSQSALKKLEAQWDQMVSKFGAAKVRLTETGWPYAGESYAGNVPSKGAMTQLFYD
YIYGWCPNKSQSYWFMMYDTTVSYTGAEHEKHWGLFGTDKSQHINMP

Enzyme Prediction     

No EC number prediction in PITG_04135-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	28	283	1.2e-17	0.977491961414791

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	4.25e-21	45	280	66	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPT50359.1|GH17	4.71e-159	1	287	1	288
UIZ21797.1|GH17	1.35e-94	20	287	566	834
UIZ21931.1|GH17	2.31e-88	1	287	1	288
UIZ21795.1|GH17	8.53e-65	1	200	1	202
CCA18992.1|GH17	5.58e-41	28	287	22	282

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	9.14e-10	37	281	38	287	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	5.47e-09	37	281	38	287	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0Y9Q9|BTGE_ASPFC	6.75e-13	43	229	328	516	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2
sp|Q4WC60|BTGE_ASPFU	6.75e-13	43	229	328	516	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2
sp|A1DBG6|BTGE_NEOFI	1.62e-12	52	236	324	508	Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgE PE=3 SV=1
sp|Q5AUT0|EGLC_EMENI	2.09e-11	55	263	57	287	Probable glucan endo-1,3-beta-glucosidase eglC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=eglC PE=1 SV=1
sp|Q04951|SCW10_YEAST	2.39e-11	28	279	138	389	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000237	0.999726	CS pos: 22-23. Pr: 0.7617

TMHMM  Annotations     

There is no transmembrane helices in PITG_04135-t26_1-p1.