CAZyme Information: PITG_04123-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_04123-t26_1-p1
• CAZy Family: GH1
• CAZyme Description: glycoside hydrolase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423	DS028122|CGC5	44887.48	5.2626

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028122:1201879-1203150(+)

Full Sequence      

MVWRVCTLAAAVAVSVAHAGPLPTGVCYAPWHHATVTCDVVGKDLTEVGQYFSSIRTFQT
LFSGVNVINSAAAAGIKVAVGVQLTEPALIDAEIEAVCDGYKANPSAVEVVYVGNENLKN
KDFGTFTADQLVGYITRIKKCVGKTPVGSVQRINEWLSAEGAATLSAACDVIGVNIYPFF
TNGPQTAVEKLQTQWEQMAVKYDADKMHVTETGWPSEGENYGANVPSLKGMQQYMDDYVE
WSKKVPQSYWFMMYDTTKSYTGAEYEKHFGVFTADGKQKITVPSGDGAQKQSNATDSSPQ
QQKKPGVSADPPASVKKDAPTNKTSTTPPATTGTPVYTFQQDSTGNEAAGTVAPFSEEGT
GTCSQIVSSGDAAVGIKIVTDKSCASGGVGCLDKICRFCKEVSSPASSKFVDCASIEGKS
PKL

Enzyme Prediction     

No EC number prediction in PITG_04123-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	25	279	3.8e-21	0.977491961414791

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	9.10e-20	23	275	45	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	6.59e-06	209	282	231	307	Glycosyl hydrolases family 17.
311610	Glyco_hydro_53	0.002	170	250	200	295	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ21797.1|GH17	1.75e-120	16	286	565	837
UPT50359.1|GH17	4.90e-114	7	283	11	288
UIZ21931.1|GH17	5.69e-72	9	283	13	288
UIZ21795.1|GH17	4.97e-53	9	195	13	200
CCA18992.1|GH17	5.13e-50	25	292	22	293

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	2.19e-09	25	285	39	297	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DBG6|BTGE_NEOFI	1.36e-08	25	226	297	503	Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgE PE=3 SV=1
sp|Q5AMT2|BGL2_CANAL	5.15e-08	66	282	68	303	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|P43070|BGL2_CANAX	3.91e-07	66	282	68	303	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|P53189|SCW11_YEAST	6.92e-07	23	227	281	494	Probable family 17 glucosidase SCW11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW11 PE=1 SV=1
sp|P53334|SCW4_YEAST	2.19e-06	25	232	135	344	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000199	0.999792	CS pos: 19-20. Pr: 0.9752

TMHMM  Annotations     

There is no transmembrane helices in PITG_04123-t26_1-p1.