CAZyme Information: PITG_03554-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_03554-t26_1-p1
• CAZy Family: CE8
• CAZyme Description: endo-1,3(4)-beta-glucanase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
659		72455.78	4.4696

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028121:2219906-2221941(+)

Full Sequence      

MKITHLIQAAVAVAGTTQSFAADTTSSGGYMAPFSTDEPSDLFQRYDTLTELAPIINVAS
DLLTKPIPTNKWWGNLIHTTKQDINTVANPAWSNPYALKLPKQAPFGLQACYSYTYRSMA
NEVNGVVKYYLHAFRNDLTLSATEFSSKPDYEIYSFSDMGASLRTCASGSDNCMDSSLVN
GMAFVSATYSGLTASIVSEYAMTIVDDSTAGKYVIQLANSQTWVVYSSDPSASFSIDSTG
SALVSNAPYTGTLRVAILPDSNEQSVYDDYASCIIHGGNVSMESRTSYTLQWETEGSGCD
STGLLHFALPHQVEVMDNAITAQSSDAIVLHSSTRGQMVGQVSTSGSWTLTESEADEEVD
FYPASRRSVDVVSKIKLLPTLQSDIDSDWSFSTGSWYFNGKAYQKYASLCLMAADSAVVG
DDTTLLSTCLTKLEKLLEPFLSNTLSSPLAYETAYKGIVTSQVFTANNIDVDFGNGIYND
HHYHYGYWITASAILKKLDPTWSGMPQLETMVWTILRDVANPSADDQYFPTFRHFSWYLG
HSYSHGVTPMADGKDEESTSEDLNFFYGMKLWGQVSENKAVEDLGSLMLRLNARAVRTYF
LMTSDNTIHPPQFVPNHVTGIFFDNKADYATWFSAEKYCIHGIQMIPVSPINGGDCYGQ

Enzyme Prediction     

No EC number prediction in PITG_03554-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	57	651	4.4e-165	0.8681672025723473

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	8.53e-124	381	651	18	280	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	7.11e-122	18	653	22	682	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	8.59e-57	64	365	12	320	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26438.1|GH81	0.0	1	653	1	668
UIZ26440.1|GH81	0.0	1	653	1	668
UIZ26131.1|GH81	4.88e-271	29	652	11	641
UIZ26137.1|GH81	2.85e-267	29	652	121	751
UIZ26602.1|GH81	2.85e-267	29	652	121	751

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	7.90e-83	65	650	39	646	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.26e-82	65	650	64	671	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	5.78e-79	65	650	39	646	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	5.96e-25	67	649	35	582	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	9.44e-22	479	657	439	611	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	2.10e-92	53	653	23	629	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	6.11e-82	64	650	223	822	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	4.01e-77	46	652	61	663	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|P53753|ENG1_YEAST	1.46e-73	35	652	407	1037	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q12168|ENG2_YEAST	2.33e-73	61	649	105	701	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000341	0.999635	CS pos: 21-22. Pr: 0.9724

TMHMM  Annotations     

There is no transmembrane helices in PITG_03554-t26_1-p1.