CAZyme Information: PITG_03533-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_03533-t26_1-p1
• CAZy Family: CE8
• CAZyme Description: endo-1,3(4)-beta-glucanase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
549	DS028121|CGC5	60765.69	4.9292

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028121:2114873-2116589(-)

Full Sequence      

MDSALVHGMAFVSATYAGLTPRIESEYAMTLQDSSTPGKYVVKLTNQQTWVIFASDMGAS
FHITGSALVSNAVYTGTLRMAILPETGDESVYDDYASCVVRGGDVSVQSRTSYSLDWETE
GSSCDSTGLLHFALPHQVEVMKEAITTKSKGVIVLHSSTRGDMVAQVTKFGSWALREDEA
DEEVDFYPSTKPSADVVAQVNLLSTLQSDIDSDWVLDKGSWYFSGKSFQKYASLCLIAAD
TTVVGDDTTLLRRCLDKLEALLKSFGTNTLSSPLVYDTTYKGIVTSLAFTTGDINADFGN
GVYNDHHYHYGYWVTASAILKKLDPSWSGIEQLDTMVWTLLRDVANPSLDDQYFPRFRHF
SCTSEDVNFYYGMKLWGQVSGNKAVEDLGSLMLRLNARTVRTYFLMTSDNTIHPPQFVPN
HVTGIFFDNKADYTTWFSAEKYCIHGIQMIPVSPINGLARTKTFIQEEWDDILSKEPIVT
GSDTSNAWLSLLLVNEAVINQADALAKLATATMDDGLTRSWLCPMPHLIKPQPTLKLRSA
LKAKLASRI

Enzyme Prediction     

No EC number prediction in PITG_03533-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	2	361	3.3e-87	0.5321543408360129

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	7.90e-132	193	521	3	347	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	2.64e-111	1	534	193	760	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	1.45e-39	5	188	123	318	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26438.1|GH81	4.18e-298	1	521	189	732
UIZ26440.1|GH81	4.18e-298	1	521	189	732
UIZ26131.1|GH81	1.22e-219	1	520	157	705
UIZ26137.1|GH81	7.06e-217	1	521	267	816
UIZ26602.1|GH81	7.06e-217	1	521	267	816

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	5.08e-80	1	543	153	729	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	7.94e-80	1	543	178	754	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.44e-75	1	543	153	729	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.82e-18	304	531	414	662	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5UPI_A	3.16e-17	304	517	439	667	Chain A, BH0236 protein [Halalkalibacterium halodurans C-125],5UPM_A Chain A, BH0236 protein [Halalkalibacterium halodurans C-125],5UPN_A Chain A, BH0236 protein [Halalkalibacterium halodurans C-125],5UPO_A Chain A, BH0236 protein [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	4.98e-82	5	525	145	698	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	1.73e-77	1	521	183	729	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|D4AZ24|ENG1_ARTBC	3.28e-77	5	521	342	894	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	2.00e-73	1	521	570	1133	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|P53753|ENG1_YEAST	1.06e-66	1	521	539	1104	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999960	0.000072

TMHMM  Annotations     

There is no transmembrane helices in PITG_03533-t26_1-p1.