CAZyme Information: PITG_03141-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_03141-t26_1-p1
• CAZy Family: CBM48
• CAZyme Description: lysosomal beta glucosidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1148		127596.88	5.2792

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028121:672792-677952(-)

Full Sequence      

MASSQQDEDTSVFEAALSFVDEFEFDTIKNDATASVNVSCPQLHQEVTSTPSHTLTIAVG
AKPPPSLSREETRRLRAEKKRMLRKAGIYSDPNRARNEHTREIAFLREQLEKLQLDLHVL
QKTKKNGLIAQYPVTQRPSLWQEQARRQRCRREQAECDNVRLKLAVERQKKVADSLGLLV
RKRTRQLNNECAALINQCCNERPIIGVSYFCGDVEDFRELFCRLDGAYHDLDAIFMANGL
TNRSVSIPDVQLREGVDGKYLEFFTYKDLPFGLQDTAQASWDYFKGAEKHMAYGNLYEKS
AKNLDDPYTIIEEFTKEVYSNSSKADVKMHQVVRRYAEEERDIVIRVSHAAPIEVRNKML
RGLTHNVRGFAVTKRSPASTSSRVLTQLQLCTQIALELKEGATCNQKNIVTYYSTVISPG
TAPLHIHRFSDFRAQPWRRCVRLATCESQAQAIVHGFSTAEVLGQMTQITITQVLNSDYS
LNEDSINGKWGWNATEWRAIVTRIQEITMEENGGHPMVYGLDSVHGANYVAGSVLFGQEI
NSEASFNPDLVYQAGRITGRDTEAAGIPWVFGPILDLSQNPLWARTYETFGEDPYLSSVM
GDAIIRGLQSNNQTAACIKHFVGYSKTPTGHDRDGVTMADFDLLNYFTQPFQAGISAGAL
SIMENYISINGIPVVANTKILEDLVRNDLNYDGVVVTDWAEINNLKDWHRVVDTYEEAVR
LSLTRTALDMSMVPYDTEFITHATEMLNSFPEYEGRLRESAKRVIKMKLKLGLYETPVPG
ANNEFLVGNDNDKAVALELARESIVLLKNDNNVLPLANGSSVFLTGHSADNVGYQCGGWS
IAWQGYSGNDMYPNGISVRQGFENLVGNNSFTYFNGLNADGSYSDADFATAVNLASQHEY
TIAVIGEATCAEKSGDIDDLDLPAGQIAYVQALAATGTKVILVLFEGRPRLLGSLPDTAN
AVIHDLLACELGGQALAEIVYGKVNPSGRLPLTYPKDSANVMIPYNHRVTTKCVDHVGPD
DSLTASVFVTNSGPVAGKETVMLFVIQPYRLISVPEVKMLRKFKKISLEPGITEEVTFTL
TADDWSVYDPPIGSGFNQVAEDGTFVVAIKPETDCDVYNTITNELCAHFTLDTGSLNFGI
NGTTSRRR

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	511	719	1.1e-59	0.9166666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.42e-93	516	1109	105	750	beta-glucosidase BglX.
224389	BglX	5.40e-64	491	841	37	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	3.72e-48	486	765	36	314	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	6.82e-42	804	997	1	192	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	6.95e-39	526	1008	100	604	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29009.1|GH3	0.0	447	1132	27	763
UIZ29613.1|GH3	1.82e-278	447	1132	71	820
UIZ29432.1|GH3	2.15e-275	447	1132	26	764
UIZ27116.1|GH3	9.75e-270	451	1131	18	724
CCA27737.1|GH3	3.48e-260	448	1131	66	808

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	3.75e-114	463	1084	30	718	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
6R5I_A	5.99e-70	458	1109	15	718	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	2.78e-69	458	1109	15	718	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5R_A	2.83e-69	458	1109	16	719	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5P_A	4.83e-69	458	1109	47	750	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	2.34e-120	458	1109	88	811	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	2.74e-113	463	1084	52	740	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|T2KMH0|PLH24_FORAG	2.88e-77	500	1122	50	719	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|P33363|BGLX_ECOLI	1.14e-67	516	1113	105	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|Q56078|BGLX_SALTY	2.10e-67	516	1080	105	725	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PITG_03141-t26_1-p1.