CAZyme Information: PITG_03140-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_03140-t26_1-p1
• CAZy Family: CBM47
• CAZyme Description: glycoside hydrolase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
753		82858.25	4.3229

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028121:667439-669751(-)

Full Sequence      

MTQVDISTIMNKDNTLNEDYVRAYAQQYVGSYLNTIWDEPLGEKYGWNATEWRAVVSRIQ
EITMEENGGHPMIYGLDSVHGANYVTGAVIFGQQINSGASFNPDLVHKAGQITARDTQAA
GIPWIFGPILEISQNPLWSRTYETFSEDPHLVTVLGEALVRGLQSYNQTGACMKHFIGYS
KTPTGHDRDNVIMDDFDLLNYFLPPFKAAMDAGAMSVMENYISINGEPVIASPRILNDLL
RSDLGFDGLLVSDWAEINNLKDWHRLDMSMVPNDTSFINYTENMLVGYPQYETRLRESAK
RIIKMKLKLGLYENPVPGEEFEFLVGNDEDKAVALDLARESIVLLKNNESVLPLAKDASV
FLTGHSADNVGHQCGGWSVAWQGYSGNEMFLNGISVRQGFEDLVGNNSFTFFNGLYENGT
YSEADLAKAVELASQHEYTIAVIGEKQYTEKPGDIDDLALPAGQIEYVEALAATGTKVII
VLFEGRPRLLGSLPDTASAIIDGLIPCELGGQAMAEIIYGDVNPSGRLPITYPKDPANVA
IPYYHRVNTQCAYDHCWMQWDFGAGLSYTEFNYSAVSLDTTTITSADATVTATVTVTNVG
IRAGKETVMLFLTQPYRTISVPEVKMLKKFKKIELQPGESQDVSFALSVDDWSVYDPQIG
KGFKKVTEDSNYVVAIKPDTWCNVYKNITHPLCAVFTIDTGRDSFGLPPPVVNVTGTNAP
VLQDPVTLPSTTDPVTEPSADEAGAGTVEAGNY

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	66	263	9e-62	0.9027777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.55e-100	71	680	105	754	beta-glucosidase BglX.
224389	BglX	1.44e-67	68	379	58	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	2.41e-46	85	650	108	743	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	7.97e-46	50	274	45	287	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	5.01e-41	342	568	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29009.1|GH3	0.0	1	704	46	768
UIZ29613.1|GH3	8.41e-315	1	699	90	820
UIZ29432.1|GH3	1.81e-302	1	699	45	764
UIZ27116.1|GH3	2.09e-280	1	698	1	724
CCA27737.1|GH3	2.83e-274	1	698	84	808

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	5.24e-119	5	692	43	765	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
1LQ2_A	4.82e-80	28	544	49	587	Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with gluco-phenylimidazole [Hordeum vulgare],1X38_A crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole [Hordeum vulgare],1X39_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole [Hordeum vulgare]
1EX1_A	5.17e-80	28	544	49	587	Beta-d-glucan Exohydrolase From Barley [Hordeum vulgare],1IEQ_A Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase Isoenzyme Exo1 [Hordeum vulgare],1IEV_A Crystal Structure Of Barley Beta-d-glucan Glucohydrolase Isoenzyme Exo1 In Complex With Cyclohexitol [Hordeum vulgare],1IEW_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 2-deoxy-2-fluoro-alpha-D-glucoside [Hordeum vulgare],1IEX_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 4I,4III,4V-S-trithiocellohexaose [Hordeum vulgare],1J8V_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 4'-nitrophenyl 3I-thiolaminaritrioside [Hordeum vulgare],3WLH_A Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare],3WLJ_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with 3-deoxy-glucose [Hordeum vulgare subsp. vulgare],3WLK_X Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with 4-deoxy-glucose [Hordeum vulgare subsp. vulgare],3WLL_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with PEG400 [Hordeum vulgare subsp. vulgare],3WLM_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with octyl-O-glucoside [Hordeum vulgare subsp. vulgare],3WLN_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with octyl-S-glucoside [Hordeum vulgare subsp. vulgare],3WLP_A Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare]
3WLI_A	5.68e-80	28	544	53	591	Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare],3WLO_A Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare],6JG1_A Chain A, Barley exohydrolase I [Hordeum vulgare subsp. vulgare],6JG2_A Chain A, Barley exohydrolase I [Hordeum vulgare subsp. vulgare],6MD6_A CRYSTAL STRUCTURE ANALYSIS OF PLANT EXOHYDROLASE IN COMPLEX WITH METHYL 2-THIO-BETA-SOPHOROSIDE [Hordeum vulgare subsp. vulgare]
6JGQ_A	1.11e-78	28	544	53	591	Crystal structure of barley exohydrolaseI W434Y mutant in complex with methyl 2-thio-beta-sophoroside. [Hordeum vulgare subsp. vulgare],6JGR_A Crystal structure of barley exohydrolaseI W434Y in complex with 4'-nitrophenyl thiolaminaribioside [Hordeum vulgare subsp. vulgare],6JGS_A Crystal structure of barley exohydrolaseI W434Y mutant in complex with 4I,4III,4V-S-trithiocellohexaose. [Hordeum vulgare subsp. vulgare],6JGT_A Crystal structure of barley exohydrolaseI W434Y mutant in complex with methyl 6-thio-beta-gentiobioside. [Hordeum vulgare subsp. vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	1.62e-133	1	676	96	811	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	1.06e-117	5	690	65	785	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|T2KMH0|PLH24_FORAG	1.29e-78	55	689	50	719	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|Q56078|BGLX_SALTY	5.45e-77	71	659	105	737	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	7.35e-76	29	659	77	737	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PITG_03140-t26_1-p1.