CAZyme Information: PITG_02968-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_02968-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: choline dehydrogenase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
588	DS028120|CGC7	65758.29	7.4681

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028120:5140044-5141904(+)

Full Sequence      

MLRHSLRCTASTLQQRASPVAARALSSSAANAEYDYVIVGGGSAGCVLANRLTEDPSNKV
LLVETGPDDRTKWDSWKIHMPAALTYNLANEKYNWFYHTEPQKHLNGRSLPWPRGRVLGG
SSSLNAMVYIRGHAYDYDDWQQSGADGWSYADCLPYFRKAQNHELGPDDYRGGDGPLNVI
RGNQKDQILFKKFIDAGVQAGYPFTEDMNGYQQEGFGWMDMTVYKGFRWSTASAYLRPAM
KRPNLTVVTDTFVSKVVFEGKKAVGVETEDRKKKNTTQQVRAAKEVILSGGAINSPQLLM
LSGIGDADHLKEVGVPVVQHLPAVGQNMEDHLDLYVQYMCKKPITLHNATWKYPHKMVAI
GLEWIFRQTGMGASSHLESGGFIRSAPGKRHPDLQYHFLPGSLTGQLTPGAYHAMQAHCS
PMRAQSRGWLKLRSNDPHEHPIIEPNYLSVEQDLVDMRNGVKLTREILEQQTLDEYRGDP
ISPSKDVWTDTQIDDWIREHTESAYHPSCTNRMGVNENTVVDPQTRVHGVENLRVVDASI
MPNIVSGNLNAPTIMIAEKAADIILGKTPLPKSTAPVYQPKNWETSQR

Enzyme Prediction     

No EC number prediction in PITG_02968-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	33	565	1.8e-171	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	0.0	33	570	7	539	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	0.0	33	588	5	555	choline dehydrogenase; Validated
366272	GMC_oxred_N	4.32e-61	106	333	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	1.71e-43	425	560	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.63e-27	15	556	35	568	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28087.1|AA3_2	0.0	1	588	1	581
CAB3230510.1|AA3_2	3.28e-246	28	587	19	578
ANI26486.1|AA3_2	3.98e-234	9	587	52	624
AWP09430.1|AA3_2	7.15e-232	34	580	20	566
CEF60566.1|AA3_2	7.59e-195	36	570	35	574

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NCC_A	1.97e-95	26	575	16	587	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
6YRU_AAA	5.05e-95	27	575	1	571	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	7.10e-95	27	575	1	571	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
7AV4_AAA	8.99e-95	26	575	76	647	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6ZH7_A	9.97e-95	27	575	1	571	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6UPE0|CHDH_RAT	1.89e-243	24	587	36	599	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
sp|Q8NE62|CHDH_HUMAN	1.49e-241	22	587	27	594	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2
sp|Q8BJ64|CHDH_MOUSE	3.47e-238	13	587	23	596	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1
sp|Q6LGH5|BETA_PHOPR	1.53e-197	31	588	2	554	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|Q48CM7|BETA_PSE14	1.00e-195	33	578	6	549	Oxygen-dependent choline dehydrogenase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) OX=264730 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PITG_02968-t26_1-p1.