CAZyme Information: PITG_02954-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_02954-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: choline dehydrogenase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
643		70891.12	7.7755

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028120:5031378-5033477(-)

Full Sequence      

MHKPPVSATVHHSTYTNCILPDGKQFPRHNFKNALSTLYMYCPLGGSPCTLPPRSRCSAA
RSNPKRLPLAVVQSSSARALSSSAAANEYDYVIVDGGSAGCVLANRLSADPTNKVLLVES
GPSDVGKWDSARIHMPAALAYNLADDRYNWNHYTEPQKNLDGRRIPWPRGRVLGGSSSIN
AMVYNRGHAVDFDDWEKSGAKGWSYADCLPYFKKSTTHDLGEDDYRGGSGPMRVTRKTQD
KAQPLFQAFIDAGVQADYPEAVDMNGYQQEGLGWMDMTIHKGKRWSAAAGYLHPAMGRKN
LTVITDTFVNKVIFEGKKAVGIEVEDNKSKSVSQIRTAKEIILSSGAINTPQLLMLSGVG
DAEHLKEMDIPLVHHLPALGKNMEDHLGTYLHFECKKPITLYNATWRFPHKMVAIALEWL
TSQTGPGSSSQIEAGGFIRTARGKTYPDLQFHFLPGSIDEGLHVRAGHVMTGHCSTMRAT
SRGYVKLRSKNPREHPIMEPNYLDTHEDIVDIRNGVKLTREIFKQKAFDEFRGDALSPSD
SAQTDEEIDAWVRQNAGTVYHPSCTARMGKDENTAVDAETRVHGMEGLRIVDASIMPNIV
SGNLNGPVIMMAEKAADIILGNPAQPKSNAPVYQAENWETSQR

Enzyme Prediction     

No EC number prediction in PITG_02954-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	88	620	1e-164	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	0.0	87	624	6	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	0.0	87	643	4	555	choline dehydrogenase; Validated
274888	Rv0697	4.81e-93	90	620	2	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
366272	GMC_oxred_N	9.77e-58	161	387	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	1.24e-42	480	615	2	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28087.1|AA3_2	5.60e-298	78	643	17	581
CAB3230510.1|AA3_2	7.33e-220	83	639	19	575
ANI26486.1|AA3_2	1.44e-213	89	640	71	622
AWP09430.1|AA3_2	4.01e-213	89	634	20	565
CEF60566.1|AA3_2	5.57e-183	91	621	35	570

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZH7_A	1.70e-93	82	621	1	562	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	3.63e-93	81	621	16	578	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
6YRU_AAA	6.60e-93	82	621	1	562	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	9.26e-93	82	621	1	562	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YS2_AAA	1.30e-92	82	621	1	562	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8BJ64|CHDH_MOUSE	1.84e-217	87	640	41	594	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1
sp|Q6UPE0|CHDH_RAT	8.22e-217	75	640	32	597	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
sp|Q8NE62|CHDH_HUMAN	9.79e-217	73	640	23	592	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2
sp|Q4K4K7|BETA_PSEF5	1.43e-183	86	635	2	549	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=betA PE=3 SV=1
sp|Q3K5H3|BETA_PSEPF	2.88e-183	88	635	4	549	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000066	0.000002

TMHMM  Annotations     

There is no transmembrane helices in PITG_02954-t26_1-p1.