CAZyme Information: PITG_02545-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_02545-t26_1-p1
• CAZy Family: AA6
• CAZyme Description: pectinesterase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
338	DS028120|CGC8	36346.13	9.2622

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028120:2565145-2566161(-)

Full Sequence      

MQFFAPLVALVYLVAGAESACTGPNARTTPPPGAIVVDATGAYRGSFKTVSEGVAKLSTA
TGDSTLFLMPGIYKEKVTVPPLKGKLIVQGYTCDTTSYSANQVTITRAMAQNDIPASITK
NRNDYTTTLLLKSSNVKVYNLNVANTAGNVGQAIAMKIDGANYGIYACKLTGYQDTLYAN
QGPALFAKSYINGAVDFIFGLYAKTWFESCDIESIGKGCVTANGRTDNSNPSEYVFNKAR
VFGSKPGQAFLGRPWRPYARVVFQNSDLSDVVDPAGWQKWNGDNNTGNVYFKEFNNRGAG
AATTKRVAFSGTLQKPVAITEILGEGYGSAWWVDKSFM

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	36	313	3.9e-72	0.9340277777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178113	PLN02497	1.93e-45	35	327	34	325	probable pectinesterase
395871	Pectinesterase	1.94e-44	35	311	2	276	Pectinesterase.
178051	PLN02432	7.18e-44	35	333	13	292	putative pectinesterase
215173	PLN02304	7.75e-44	30	313	67	354	probable pectinesterase
215117	PLN02176	1.25e-43	35	309	41	309	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFM08806.1|CE8	7.39e-250	1	338	1	338
ACO54869.1|CE8	2.40e-214	1	338	1	338
ACO54873.1|CE8	3.34e-153	1	338	1	344
ABQ63096.1|CE8	1.35e-152	1	338	1	344
ACO54868.1|CE8	1.38e-149	1	338	1	343

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1E_A	4.82e-56	25	337	1	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	6.79e-56	25	337	1	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1GQ8_A	3.16e-36	19	311	2	283	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	4.67e-32	45	311	13	279	Chain A, Pectinesterase 1 [Solanum lycopersicum]
3UW0_A	1.03e-10	55	302	49	336	Pectin methylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	2.78e-72	27	338	20	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	2.21e-71	27	337	20	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|B0Y9F9|PMEA_ASPFC	4.38e-63	27	337	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	4.38e-63	27	337	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	8.73e-63	27	337	28	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.004439	0.995547	CS pos: 19-20. Pr: 0.9005

TMHMM  Annotations     

There is no transmembrane helices in PITG_02545-t26_1-p1.