CAZyme Information: PITG_01869-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_01869-t26_1-p1
• CAZy Family: AA17
• CAZyme Description: alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
833		94844.97	8.7735

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028119:4752611-4755839(-)

Full Sequence      

MAPPDGWTPETPVIIAANRLPVRLFRTSDGQWHVEWAGDRMIESQNTLSHYEISERATIK
FVGRVVDADVPFEERQQVELLLREFNCFPVFLEPQEAKLYYEDYCKQTLWPTFHNVVDVY
SPVDVVLDVQAQQHLTPSAQFWNPNWQKVAWQAYANVNQLFAHKICELYEQGDVVWVQDY
HLLLTPSYIVRKLRAANVGLFLHVPFPSSEVFRTVSMRKELLRGMLNADHIGFHLFEYAR
HFMSACRRILGLSYEPILRGQLGIDYGGRRVAVTCSHMAIDVQRIEETLVSKDVRDMVVA
LRQKYRDKKIFAGCDSIERLKGIPSKMLAFDGFLSRCPDFIGKAVLVQKGIHRRGRVTDY
LQSKKEIELAVKAINSKYRDVAKGNVVDYEECVLTDIVNARKKEESFVYMGTGFGLDFRL
MEVSAQFRKLTGQELTPAYRTSTNRAIFLDYYRTLAPDVSTLMGVRWPDVPLSALSTLEH
LCKDPRNTVFIVSGCNCDLLTQKFGGVPGLGLVAEHGYFIRRAVLGNNARIGRPWERHGD
ILQSDGGHQQWRVKAEKIVQLYVDRTNGSTLELRRSAVLFRYGKSDFDFGALQAAELKEH
LEGVFEGWPLNIIQGKDYIEVRPEGVGKGKLIGHLLNKMRVDGNPTDFVLCIGDDVADEL
MFEQLKTMTAHEELPQDKVFTCTVGQKPSKAEFFVDDYTDVIALLKSLKVVATKSNRNYS
LSDMQSFVRDTRPFLSSSSHGTSGVSRSATSDAVIRKSSSRHALYNHLTPVIEDQINTWL
NRLQQLGVVAVLVGILRWRSGVKNPREKKLLMYLVASLGIAWSIQRLRSRPHK

Enzyme Prediction     

No EC number prediction in PITG_01869-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	12	389	2.4e-101	0.7242105263157895

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
177855	PLN02205	1.16e-147	3	714	52	850	alpha,alpha-trehalose-phosphate synthase [UDP-forming]
184712	PRK14501	3.04e-134	13	708	3	723	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	4.24e-105	12	378	1	337	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	3.74e-101	13	378	3	342	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215555	PLN03063	3.83e-95	13	720	13	795	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27356.1|GT20	0.0	3	768	14	886
CCA16404.1|GT20	2.93e-269	10	774	3	884
UIZ24099.1|GT20	6.17e-145	13	730	292	1140
CCA19238.1|GT20	4.32e-144	13	727	265	1095
VDC76484.1|GT20	4.01e-132	14	719	59	845

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVO_A	7.58e-63	1	381	1	352	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HVM_A	9.24e-63	10	381	11	352	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	1.66e-59	13	378	2	337	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HUV_A	7.55e-58	13	381	6	345	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HUT_A	1.04e-57	13	381	6	345	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9LRA7|TPS9_ARATH	2.19e-129	14	719	62	850	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 OS=Arabidopsis thaliana OX=3702 GN=TPS9 PE=2 SV=1
sp|O80738|TPS10_ARATH	2.00e-128	14	708	62	839	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 10 OS=Arabidopsis thaliana OX=3702 GN=TPS10 PE=2 SV=1
sp|O23617|TPS5_ARATH	1.25e-125	13	713	62	844	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 OS=Arabidopsis thaliana OX=3702 GN=TPS5 PE=1 SV=2
sp|Q0WUI9|TPS8_ARATH	6.15e-124	14	708	60	834	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 8 OS=Arabidopsis thaliana OX=3702 GN=TPS8 PE=2 SV=1
sp|Q94AH8|TPS6_ARATH	1.48e-121	8	711	50	853	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 OS=Arabidopsis thaliana OX=3702 GN=TPS6 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000076	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PITG_01869-t26_1-p1.