CAZyme Information: PITG_01269-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_01269-t26_1-p1
• CAZy Family: AA17
• CAZyme Description: glycoside hydrolase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315		35444.51	4.7385

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028119:578796-579792(-)

Full Sequence      

MFDSNTGDYFAVKGVDYYPRPNSGELNVNNYDFFSDDNSSIWKDDIAYLAEAGVNAVRLY
AVDPSKSHDGFMCELRKYGMYALVDLGASCENCSITVDEYPACYPGALKTRGQQIITEFA
QYDNTLGFSAGNEINNLVKDASTNAPCQKKFIRDMRAFIGGCSSTMRSIPVGVVMADPDT
TNNNRELNAQYYNCRTESSDKYENAEWYGLNTDQYCDGDVTELADADGFSQLLTDFSNYS
MSIPVMLTEYGCVNPSFPTVGKYEAQRTWRQAGWLLGEKWPTRTARVRPRRRIHSQPTAR
KLWSGLLLARGMRLD

Enzyme Prediction     

No EC number prediction in PITG_01269-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	1	279	1.7e-68	0.8012820512820513

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	6.08e-45	2	252	20	249	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
225344	BglC	0.006	38	144	71	201	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27746.1|GH72	1.09e-142	1	276	32	306
AIG55902.1|GH72	2.96e-119	1	278	27	312
AIG55987.1|GH72	1.10e-118	1	278	48	318
CCA23775.1|GH72	8.11e-113	1	275	32	301
AIG55654.1|GH72|GT31	1.50e-110	1	280	30	307

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	1.48e-23	1	252	43	278	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
2W61_A	3.68e-23	1	252	43	278	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]
5FIH_A	3.68e-23	1	252	43	278	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AJY5|PGA4_CANAL	8.78e-31	1	252	29	257	1,3-beta-glucanosyltransferase PGA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PGA4 PE=1 SV=1
sp|Q08193|GAS5_YEAST	3.56e-27	1	252	37	265	1,3-beta-glucanosyltransferase GAS5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAS5 PE=1 SV=1
sp|O13692|GAS5_SCHPO	8.07e-27	1	252	36	264	1,3-beta-glucanosyltransferase gas5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gas5 PE=1 SV=1
sp|Q08271|GAS4_YEAST	1.13e-26	3	279	35	287	1,3-beta-glucanosyltransferase GAS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAS4 PE=1 SV=1
sp|Q9Y7Y7|GAS4_SCHPO	1.12e-24	1	252	35	260	1,3-beta-glucanosyltransferase gas4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gas4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PITG_01269-t26_1-p1.