CAZyme Information: PITG_01138-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_01138-t26_1-p1
• CAZy Family: AA17
• CAZyme Description: beta-galactosidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
706		79495.65	6.4167

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028118:6552956-6555424(+)

Full Sequence      

MFSEEDADYEALLPVDAPNAPPKCRRRLQRMDVALLSVILFVACYVGVRPPALRVSNPLM
LKSSNFQYLTYDGIDATKRQSGYSVTYSPRGFEIDGKQTLLLGGSIHYPRSSPGEWEQLL
REAKRDGLNHIEMYVFWNLHEQERGVFNFAGNANITRFYELAAEVGLFLHVRFGPYVCAE
WNNGGLPLWLNWIPGMEVRSSNAPWQREMERFIRYMVELSRPFLAKNGGPIIMAQIENEF
AWHDPEYIAWCGNLVKQLDTSIPWVMCYANAAENTILSCNDDDCVDFAVKHVKERPSDPL
VWTEDEGWFQTWQKDKKNPLPNDQRSPEDVAYAVARWFAVGGAAHNYYMYHGGNNYGRAA
SAGVTTMYADGVNLHSDGLSNEPKRTHLRKLHEALIECNDVLLRNDRQVLNPRELPLVDE
QTVKASSQQRAFVYGPEAEPNQDGAILFDTADVRKSFPGRQHRTYTPLVKASALAWKAWS
ELNVSSTTPRRRVVADQPIEQLRLTADQSDYLTYETTFTPKQLSDVDDDMWTVKVTSCEA
SSIIALVDGWLIGERNLAYPGGNCSKEFSFHLPASIEVGRQHDLKLVSVSLGIYSLGSNH
SKGVTGSVRIGHKDLARGQRWEMYPSLIGEQLEIYRSQWIDAVPWTPVSRAAGGRQLMSC
RPYCSISSDSHVAARILTATTWAATGLSTTRGTLFNATTTSHATGW

Enzyme Prediction     

No EC number prediction in PITG_01138-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	92	393	2.3e-88	0.993485342019544

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396048	Glyco_hydro_35	5.00e-98	92	392	2	315	Glycosyl hydrolases family 35.
166698	PLN03059	6.79e-95	84	657	29	620	beta-galactosidase; Provisional
224786	GanA	2.94e-20	85	450	1	409	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
396834	Glyco_hydro_42	4.24e-05	107	246	6	144	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26848.1|GH35	0.0	1	659	1	703
CCA17560.1|GH35	6.18e-213	13	645	19	687
ACD54699.1|GH35	1.50e-127	64	647	16	615
UJR36785.1|GH35	4.55e-126	69	645	22	612
ACD54708.1|GH35	6.41e-126	64	647	16	615

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5F_A	2.21e-82	80	645	3	587	Chain A, Beta-galactosidase [Solanum lycopersicum],3W5F_B Chain B, Beta-galactosidase [Solanum lycopersicum],3W5G_A Chain A, Beta-galactosidase [Solanum lycopersicum],3W5G_B Chain B, Beta-galactosidase [Solanum lycopersicum],6IK5_A Chain A, Beta-galactosidase [Solanum lycopersicum],6IK5_B Chain B, Beta-galactosidase [Solanum lycopersicum]
6IK6_A	1.60e-81	80	645	3	587	Chain A, Beta-galactosidase [Solanum lycopersicum],6IK6_B Chain B, Beta-galactosidase [Solanum lycopersicum],6IK7_A Chain A, Beta-galactosidase [Solanum lycopersicum],6IK7_B Chain B, Beta-galactosidase [Solanum lycopersicum],6IK8_A Chain A, Beta-galactosidase [Solanum lycopersicum],6IK8_B Chain B, Beta-galactosidase [Solanum lycopersicum]
4MAD_A	1.41e-43	92	403	24	347	Chain A, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
6EON_A	5.18e-36	82	451	17	410	Galactanase BT0290 [Bacteroides thetaiotaomicron VPI-5482]
4E8C_A	7.58e-35	92	357	10	284	Crystal structure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8C_B Crystal structure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8D_A Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4],4E8D_B Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9MAJ7|BGAL5_ARATH	2.61e-88	84	656	30	622	Beta-galactosidase 5 OS=Arabidopsis thaliana OX=3702 GN=BGAL5 PE=2 SV=1
sp|Q9SCU9|BGA13_ARATH	1.91e-87	85	649	44	629	Beta-galactosidase 13 OS=Arabidopsis thaliana OX=3702 GN=BGAL13 PE=2 SV=1
sp|Q6ZJJ0|BGA11_ORYSJ	9.89e-87	73	647	23	618	Beta-galactosidase 11 OS=Oryza sativa subsp. japonica OX=39947 GN=Os08g0549200 PE=2 SV=1
sp|Q54MV6|BGAL2_DICDI	1.85e-86	84	645	39	620	Probable beta-galactosidase 2 OS=Dictyostelium discoideum OX=44689 GN=glb2 PE=3 SV=1
sp|Q8RUV9|BGAL1_ORYSJ	6.73e-86	84	608	30	568	Beta-galactosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0533400 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000019	0.000005

TMHMM  Annotations     

Start	End
33	52