CAZyme Information: PITG_01133-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_01133-t26_1-p1
• CAZy Family: AA17
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373		39508.26	4.1535

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028118:6530003-6531124(+)

Full Sequence      

MARIHSIVAFSVALLATLLFTCVYAADDQALPWDGTFHDLAVDTLTDKYLTHILTNRQSG
TVSPDQWVTITKKGRSPAFNGDTGVATLAVDSEAIFGGQTNFRRSELVQDVAGNTAGTTF
FRVSLLKKEAYVNLYSWQVVFPESHLFEIRIDASVDPVQLVWYTGGSTETRWSTEFKTKT
WYNFGIAVSAGKLALYFSEGDDALALTKTETYNGAVPTDYEFHFGQLTLSNDGSAVKMAD
KQDVLSFNGVTVENGIPSDLGSPTSSVASSGTGSESASTPASTPAPVATTGTPTVTAATP
STETSEQDSASEADTNTGSEAAEETTETPATTTAAPPATEAPSTSTDQTSDTDTPAPEDT
PTISTSGCKVRRY

Enzyme Prediction     

No EC number prediction in PITG_01133-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	70	255	1.8e-24	0.792156862745098

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	6.38e-46	31	257	1	250	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26845.1|GH131	1.71e-121	4	266	5	267
CCD28226.1|GH131	7.30e-69	27	261	18	257
UIZ26396.1|GH131	4.86e-62	12	253	11	259
CCA28146.1|GH0	3.64e-20	24	260	15	255
QSZ36752.1|CBM1|GH131	3.19e-16	10	255	3	247

PDB Hits     

PITG_01133-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

PITG_01133-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000235	0.999743	CS pos: 25-26. Pr: 0.9808

TMHMM  Annotations     

Start	End
7	26