CAZyme Information: PITG_01003-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_01003-t26_1-p1
• CAZy Family: AA17
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
725		81232.09	8.4431

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028118:5876437-5878788(-)

Full Sequence      

MMLEVSPREACALIVFTVALLTAWNANSNGFVWDDRSAVLANDDAQSSSLIDVFSHDFWG
TPIRSVHSHKSYRPLTILSFRLNYLMAKGHSAWLYHFTNAVVHAGCSVLVWKVADVLFQQ
HQRRMETVTIKENPQDSSPIESNTVMKTENAVEWTNLVGALTAGLLFAVHPIHCDAVASI
VGRADLLCTSLSLSAFLAYTSGAKKRETSWRHVMVALALTIVAGLCKELGFTNFALLMVY
DLLRIHRYRNVQRGLQLVQRRLLVTVTTGIVAALVRVWINGEHRQMEWNILANSVVVQES
RLTRMLSYSHLHAWYLWKLVWPRWLCFDYGYNTIPVIESIVDPRNIYTLFAYVIVAVGLR
SAILQLFGSSKAPPSSLFMMSIAFGVVPFIPASNMLFPVGTVVAERLLYFPSVGFCLLVG
CLRNADWMSEQTLFKAAVDVVPTNVKVLSNEAKNLLNPDPKKALDYLRIAIGMIPKHIES
QTNAGLAFITLAARKGLDEDLYLHGIRHLHKSSVLAPNHFQAVGFIGGELYTHWMNKARL
RSEEVTIGDFLASESIVQATKFLDRAIDRNSVYPTHFYNRGSIAYESGDYDEAIRFFRLT
EVANGVIRDRRVDPELLVEASSIYNMLGVSYRNKGESEKALEMLRKGIELYPKEIDLHIN
AALILHNIGNTDEAAAQIKAGLATATKQEHIARLRSAAKLLENSKIMYVVEALLDHAAKL
EQAFL

Enzyme Prediction     

EC	2.4.1.109:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT105	82	248	3e-33	0.9465648854961832

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400627	DUF1736	8.94e-21	299	356	17	74	Domain of unknown function (DUF1736). This domain of unknown function is found in various hypothetical metazoan proteins.
276809	TPR	6.34e-13	577	683	4	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
223533	TPR	1.21e-08	558	708	148	287	Tetratricopeptide (TPR) repeat [General function prediction only].
276809	TPR	5.60e-08	558	649	19	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
274350	PEP_TPR_lipo	8.68e-08	459	725	208	499	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE38405.1|GT105	8.48e-64	14	673	16	654
AAI66274.1|GT105	8.57e-63	14	480	24	514
CAD7262601.1|GT105	1.66e-62	13	583	5	572
Q5T4D3|GT105|2.4.1.109	2.34e-62	4	455	15	492
AWP07866.1|GT105	3.59e-62	24	669	21	645

PDB Hits     

PITG_01003-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5T4D3|TMTC4_HUMAN	4.15e-63	4	455	15	492	Protein O-mannosyl-transferase TMTC4 OS=Homo sapiens OX=9606 GN=TMTC4 PE=1 SV=2
sp|Q8BRH0|TMTC3_MOUSE	1.25e-61	14	572	16	577	Protein O-mannosyl-transferase TMTC3 OS=Mus musculus OX=10090 GN=Tmtc3 PE=1 SV=2
sp|Q6ZXV5|TMTC3_HUMAN	5.64e-61	14	669	9	646	Protein O-mannosyl-transferase TMTC3 OS=Homo sapiens OX=9606 GN=TMTC3 PE=1 SV=2
sp|Q8BG19|TMTC4_MOUSE	1.27e-60	4	468	14	506	Protein O-mannosyl-transferase TMTC4 OS=Mus musculus OX=10090 GN=Tmtc4 PE=2 SV=1
sp|Q7K4B6|TMTC3_DROME	3.90e-56	13	583	38	640	Protein O-mannosyl-transferase Tmtc3 OS=Drosophila melanogaster OX=7227 GN=Tmtc3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.007499	0.992472	CS pos: 28-29. Pr: 0.6360

TMHMM  Annotations     

Start	End
12	34
92	114
215	237
257	279
346	368
378	400
407	427