CAZyme Information: PITG_00299-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_00299-t26_1-p1
• CAZy Family: AA1
• CAZyme Description: alpha-1,3-mannosyltransferase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1488	DS028118|CGC4	166519.55	6.8386

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028118:1696620-1701478(-)

Full Sequence      

MESRGARWAAAFGLQGDVLAAQRERYERLKQHMVFQIDATGITDPLTAFAAANGSPSANS
SSWSQYFTDETLLEEINTDLERLYPAGNESFFQNELYLSTLRHVLFVWCRLHPDVAYRQG
MHDVVAVVLYAFLQTTKEGNTEEDQVKNLPNQPEADTFLVFEAVMLFLKPFYEIIKTRRN
TARDNEDSRRLFASFSLKESESSNGHETQPALHRLCHHIQFELLQQKDPQLYYQLQNLEI
VPETYCLRWIRLLFAREYALKELLWVWDAMILDNSRADVIFPVINMTVKSDNDLLQLPKL
ACKSEDTNWTGFPLLRYVCVARLLQLSSELRQSDNTGCLRLLMRTYQGEELDGEENRAVE
LMNFAKVLQDPMAEEQQQSASDVANSDKGSSSVKVVQFKEGSLGIVLTGAAAPYDDRLAV
KSFTRDPNATDGVGQAEASGKVRLGDLLQSINGVPIVGVTTEEVKRRLQLINRPVYIGFC
HCSDVYAAVSDGSEAIGSSDAAGSSPRSETALSELVLPVFLPGELCYANVETSMQRLVLS
HDGSCQSHYISGKLFITNYRCFFTRLLGRGEIDWQIPVLSITSIDRINPRDNSTTAAATL
SVENAQVALGFAPDDSFKVVIRCKDLQVARLSIADQSEYSKLVKCLSFLAFPQSLLDAFC
FAYAPTVAPSEEVQFDIRQEYKRIGLLSFPGHLRCIDQSVTYTLCETYPRHLIVPADISD
VRLKAAAAFRAHQRLPVVSWIHRGNGATIVRSSQPLVGLKSARSGEDELLVTLSCCSSNK
KAFGRYVIMDARSQLAAVGNKALGKGTEISSNYRGAKLIFMNVENIHSVRQSQLALAATF
EPKKSASEDTSSSFYGRIDSSGWLRHVRLVLEASVELAHTVHNAQMVALAELMLDPYYRT
LRGFQILVEKEWCAFGHQFALRSGHARSDVSNEQRSPVFLLWLDCVWQYIRQYPTECEFN
ESFLLTLADHVYSCKFGTFMFDCERQRKDFFAKHRVFSVWSEINTQSERFTNHMYAPSEQ
ATVLSPSTLSKNIKPMALPPPPALAAIVAPWVLVLIFVVWGFFRGLNCSIPRPVRQSKET
KKLRVGFVHPDFGIGGAENLVVNAAVALQQRGAHVTVFTAHHDVNHCFEETRGDGPLAAH
VRVHGDWLPRTILGKLYALCAVVRVLFVTLCIAISYINDVDVFVVDQVSISIPFLRALGK
PVLFYGHFPDKLLCIRSDSPWKRMYRIPLDYLEEITTAASDIIVANSKFSREVFQKVFPR
LRSKKLGILYPPVDVKAYEATAEADVQRDSGLFVSLNRFERKKNVALAIEALVELRTRLP
SDEFQRVKLIVAGGYDPLNTENKEHLIELQAVVVKHGLKEHVEFRTSVSNSMKLELLRKA
HGILYTPDREHFGIVPVEAMACGTPVIAVSSGGPLESIADGETGFLCQQKPEAFAEAMAK
LCGPKNSTKVVEMSACGRLRAQKLFSLETFGDTLLELVNQAVYGEKAA

Enzyme Prediction     

EC	2.4.1.257:6	2.4.1.132:6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	1292	1442	9e-39	0.8625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340834	GT4_ALG2-like	1.45e-169	1083	1474	1	392	alpha-1,3/1,6-mannosyltransferase ALG2 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ALG2, a 1,3-mannosyltransferase, in yeast catalyzes the mannosylation of Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. A deficiency of this enzyme causes an abnormal accumulation of Man1GlcNAc2-PP-dolichol and Man2GlcNAc2-PP-dolichol, which is associated with a type of congenital disorders of glycosylation (CDG), designated CDG-Ii, in humans.
399535	Myotub-related	4.71e-149	675	988	8	330	Myotubularin-like phosphatase domain. This family represents the phosphatase domain within eukaryotic myotubularin-related proteins. Myotubularin is a dual-specific lipid phosphatase that dephosphorylates phosphatidylinositol 3-phosphate and phosphatidylinositol (3,5)-bi-phosphate. Mutations in gene encoding myotubularin-related proteins have been associated with disease.
350357	PTP-MTM-like	5.69e-100	733	948	1	226	protein tyrosine phosphatase-like domain of myotubularins. Myotubularins are a unique subgroup of protein tyrosine phosphatases that use inositol phospholipids, rather than phosphoproteins, as substrates. They dephosphorylate the D-3 position of phosphatidylinositol 3-phosphate [PI(3)P] and phosphatidylinositol 3,5-bisphosphate [PI(3,5)P2], generating phosphatidylinositol and phosphatidylinositol 5-phosphate [PI(5)P], respectively. Not all members are catalytically active proteins, some function as adaptors for the active members.
350380	PTP-MTMR6-like	3.53e-91	677	973	1	301	protein tyrosine phosphatase-like domain of myotubularin related phosphoinositide phosphatases 6, 7, and 8. This subgroup of enzymatically active phosphatase domains of myotubularins consists of MTMR6, MTMR7 and MTMR8, and related domains. Beside the phosphatase domain, they contain a C-terminal coiled-coil domain and an N-terminal PH-GRAM domain. In general, myotubularins are a unique subgroup of protein tyrosine phosphatases that use inositol phospholipids, rather than phosphoproteins, as substrates. They dephosphorylate the D-3 position of phosphatidylinositol 3-phosphate [PI(3)P] and phosphatidylinositol 3,5-bisphosphate [PI(3,5)P2], generating phosphatidylinositol and phosphatidylinositol 5-phosphate [PI(5)P], respectively. MTMR6, MTMR7 and MTMR8 form complexes with catalytically inactive MTMR9, and display differential substrate preferences. In cells, the MTMR6/R9 complex significantly increases the cellular levels of PtdIns(5)P, the product of PI(3,5)P(2) dephosphorylation, whereas the MTMR8/R9 complex reduces cellular PtdIns(3)P levels. The MTMR6/R9 complex serves to inhibit stress-induced apoptosis while the MTMR8/R9 complex inhibits autophagy.
350383	PTP-MTM1-like	3.33e-74	734	972	2	249	protein tyrosine phosphatase-like domain of myotubularin, and myotubularin related phosphoinositide phosphatases 1 and 2. This subgroup of enzymatically active phosphatase domains of myotubularins consists of MTM1, MTMR1 and MTMR2. All contain an additional N-terminal PH-GRAM domain and C-terminal coiled-coiled domain and PDZ binding site. In general, myotubularins are a unique subgroup of protein tyrosine phosphatases that use inositol phospholipids, rather than phosphoproteins, as substrates. They dephosphorylate the D-3 position of phosphatidylinositol 3-phosphate [PI(3)P] and phosphatidylinositol 3,5-bisphosphate [PI(3,5)P2], generating phosphatidylinositol and phosphatidylinositol 5-phosphate [PI(5)P], respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ22829.1|GT4	3.86e-273	1036	1488	1	453
CCA25726.1|GT4	6.48e-155	1044	1480	8	447
AAH92211.1|GT4	6.23e-107	1087	1483	7	404
AAH77444.1|GT4	5.24e-104	1087	1474	7	395
AAH49444.1|GT4	1.12e-101	1074	1474	13	413

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C16_A	1.12e-83	550	1030	29	498	Myotubularin-related proetin 1 [Homo sapiens],5C16_B Myotubularin-related proetin 1 [Homo sapiens],5C16_C Myotubularin-related proetin 1 [Homo sapiens],5C16_D Myotubularin-related proetin 1 [Homo sapiens]
1ZSQ_A	1.23e-83	550	1015	32	487	Chain A, Myotubularin-related protein 2 [Homo sapiens],1ZVR_A Chain A, Myotubularin-related protein 2 [Homo sapiens]
1LW3_A	2.72e-83	507	1015	68	559	Chain A, Myotubularin-related protein 2 [Homo sapiens],1M7R_A Chain A, Myotubularin-related Protein-2 [Homo sapiens],1M7R_B Chain B, Myotubularin-related Protein-2 [Homo sapiens]
5GNH_A	3.83e-83	550	1015	29	484	Myotubularin-related protein 2 [Homo sapiens],5GNH_B Myotubularin-related protein 2 [Homo sapiens]
2YF0_A	9.76e-79	619	1034	68	493	Human Myotubularin related protein 6 (MTMR6) [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9H553|ALG2_HUMAN	6.30e-95	1075	1480	7	413	Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Homo sapiens OX=9606 GN=ALG2 PE=1 SV=1
sp|Q9DBE8|ALG2_MOUSE	1.04e-93	1087	1482	19	415	Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Mus musculus OX=10090 GN=Alg2 PE=1 SV=2
sp|O94738|ALG2_RHIPU	1.01e-90	1080	1474	3	416	Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Rhizomucor pusillus OX=4840 GN=ALG2 PE=1 SV=1
sp|Q13496|MTM1_HUMAN	5.03e-85	550	1034	59	532	Myotubularin OS=Homo sapiens OX=9606 GN=MTM1 PE=1 SV=2
sp|A6QLT4|MTM1_BOVIN	5.03e-85	550	1034	59	532	Myotubularin OS=Bos taurus OX=9913 GN=MTM1 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

Start	End
1041	1063
1156	1178