CAZyme Information: PITG_00219-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_00219-t26_1-p1
• CAZy Family: AA1
• CAZyme Description: glucan 1,3-beta-glucosidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356		38544.21	4.2195

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028118:1380924-1382111(+)

Full Sequence      

MVRVLALSAAAVAALASSTSALDQKLYGLNYDLRQGPDWDPSKCKSADTIAADLKILSTI
TSNVRTYSLSDCDVTGVLKAAKDLSLTVWLGVWVSEDEKVYDAEVKAFKELISAGLIDSN
VVGINVGSEAVYREDISAQQAIKYVTDFKKVMSDNDISVPVSITDIIDTFVQYPDMLKAG
DIVTINQFPFWEKIEADKAAAQFNKRIQPLLKMAGDMEVIISETGWPTGGSAKNGSVASE
ENGAVFLNDFYQLAESKGWKYYYFAGFDTPYKEEQADDATTVESHFGIFDDKGTMKPAYE
NLKFTKNDDLGTSGSSDTTTSSGSTSTISTENGSSQLVAASFVAVIGVVSTMFWSL

Enzyme Prediction     

No EC number prediction in PITG_00219-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	43	296	3.6e-23	0.9453376205787781

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	4.29e-41	36	289	51	301	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	8.63e-18	28	296	2	304	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56146.1|GH17	3.39e-84	14	305	10	301
AIG55438.1|GH17	1.97e-82	1	302	1	309
AIG55390.1|GH17	6.92e-82	7	306	7	313
AIG56392.1|GH17	3.10e-80	3	306	2	310
AIG56195.1|GH17	1.73e-71	15	305	6	313

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	2.14e-36	24	297	35	290	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.59e-35	24	297	35	290	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QN74|BTGC_ASPNC	5.13e-25	46	297	401	671	Putative glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=btgC PE=3 SV=2
sp|Q0CI96|BTGC_ASPTN	2.98e-24	22	296	354	641	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=btgC PE=3 SV=2
sp|Q2U492|BTGC_ASPOR	1.87e-23	46	297	402	672	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=btgC PE=3 SV=1
sp|B8NTP7|BTGC_ASPFN	1.87e-23	46	297	402	672	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=btgC PE=3 SV=2
sp|P43070|BGL2_CANAX	4.69e-23	40	296	31	300	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000253	0.999708	CS pos: 21-22. Pr: 0.9521

TMHMM  Annotations     

There is no transmembrane helices in PITG_00219-t26_1-p1.