CAZyme Information: PIS53863.1

Basic Information

• Species: [Candida] auris
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] auris
• CAZyme ID: PIS53863.1
• CAZy Family: GT15
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
703		77603.02	6.2332

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CaurisB11221	5715	N/A	194	5521

• Gene Location: location=PGLS01000004:2964477-2966588(+)

Full Sequence      

MSNIFASAVDTTEPIALFERKPGETAVPEGVSNSSPLHTNSFYCNMLVENRDCTVWTHPY
SVWNSKTNKRFGLAAYLARDSDRVFGEGDPAEFFSHPVGVQRIVLSSSDFKEEPSFSLHS
LSKFAATARFSSKSERDCYLDCPLVQGMGFVTGVYHNCIPKISSQVGFKSVEGDTSPRSG
TSKYKVELDDGTKWLVYVTLPEGATLELALKGNNEIIADKSVDDGIVQICFASDVDTKSY
DAAAGCYASDASISASIDGNKCSYSLSYSTKGSSNSNSTLVFALPHHVEAFDGETKGKAT
SITLQTTTKGKALGILSNKLTMVEELTMKDVTWDPATTIPGKKANYSQTALEAIREAAKN
EVNGDVEKDSNVDSMYFGGKVLAKYAFVLLVCHRILKDGGLTNSLLPKMKKAINRFKSNK
QQYPLFYDTSFKGIVSSAKEGSDFGNGHYNDHHFHWGYHIQAAAITAFVDKDLGGKWIDE
IKHWVNSLVRDIANPTTDDKHFPVFRAFDFYNGHSWAKGLYASADGKDEESSSEDYNHAY
ALKLWANVLGDGDQEKRADLMLAIMSRSMNCYFLMSDDNKIQPSQFIGNKVTGILFENKA
HHTTYFGTNEEYIQGIHMIPVNPVSSFIRKPEFVKQEWEQKLQGLVGNLNDGWRGILMLN
AALFDPDMAWKFFSDGNFSKDHLDGGQSKTWSLAYCAGVGASS

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	32	695	2.6e-219	0.9758842443729904

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	7	702	59	758	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	345	693	1	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	6.71e-117	28	335	5	318	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEO21153.1|GH81	0.0	1	703	1	703
QEL58583.1|GH81	0.0	1	703	1	703
QWW21793.1|GH81	0.0	1	698	1	698
QRG36947.1|GH81	0.0	1	703	1	703
QWU88126.1|GH81	0.0	1	698	1	697

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.40e-91	125	693	138	712	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	2.36e-91	125	693	163	737	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	2.91e-88	125	693	138	712	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.95e-27	343	689	312	646	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	1.67e-19	450	669	439	654	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12168|ENG2_YEAST	1.08e-190	3	695	74	774	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|P53753|ENG1_YEAST	5.79e-188	3	702	401	1115	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	5.34e-182	8	699	431	1141	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	1.46e-176	34	698	223	901	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	5.31e-169	32	702	30	705	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999771	0.000274

TMHMM  Annotations     

There is no transmembrane helices in PIS53863.1.