CAZyme Information: PIS53755.1

Basic Information

• Species: [Candida] auris
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] auris
• CAZyme ID: PIS53755.1
• CAZy Family: GT15
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423	PGLS01000004|CGC20	48152.43	9.2296

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CaurisB11221	5715	N/A	194	5521

• Gene Location: location=PGLS01000004:2709302-2710573(+)

Full Sequence      

MNSITRLFLVFVAIKTTHLLIFYHSPGQFDISSALLLQKYQAEKEILSTASLTPFASLNS
LISTGIRSILDNFVDKLATWDAVYFADLFVNGITYEHQYVFCPLWWRLIRSFPVNSETVF
YQRLTYATLLSNVCHFVAAIVLYKYTQAIFMQARLFPPTRMAELTATFYLLSPAAAYLTA
PYSESIAALFSLLCLFCREKAVEFSIRGNPHSVKKQVVYVASGVFASLAFGFRANCLFLG
AIYIYDLVRRKSVSPLLPLAAGSILGLAFLFSNIHSYYAICSSGDRGEWCLNRFPSLFAY
AQSHYWNNGFFRYWTPNNIPNFLFGAPVIGLSLFSIRYFSKDYPVIQILPASIVNGIFLT
ALLIFWHVQIVTRIHTFVPPMYWLCAGLWIHDDYPRLKKLVLGYFILWNIVQAALFATFL
PPA

Enzyme Prediction     

No EC number prediction in PIS53755.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	12	423	5.7e-90	0.9852579852579852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.41e-37	66	423	46	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.78e-18	129	423	121	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWW21893.1|GT76	4.64e-312	1	423	1	423
QEL58691.1|GT76	4.27e-308	1	423	1	423
QWU86765.1|GT76	3.22e-186	6	404	5	403
QBM91037.1|GT76	1.19e-160	1	423	37	495
SGZ51552.1|GT76	1.95e-150	1	423	1	427

PDB Hits     

PIS53755.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6BRZ9|GPI18_DEBHA	3.91e-114	1	423	1	428	GPI mannosyltransferase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GPI18 PE=3 SV=1
sp|Q59VN0|GPI18_CANAL	5.58e-88	6	423	4	394	GPI mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPI18 PE=3 SV=1
sp|Q757K7|GPI18_ASHGO	1.13e-60	1	423	1	427	GPI mannosyltransferase 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=GPI18 PE=3 SV=1
sp|Q6CMW6|GPI18_KLULA	2.97e-57	11	423	17	417	GPI mannosyltransferase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=GPI18 PE=3 SV=1
sp|Q6FWN4|GPI18_CANGA	8.53e-57	1	423	1	433	GPI mannosyltransferase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.821296	0.178702

TMHMM  Annotations     

Start	End
129	151
174	196
217	239
254	276
314	336
346	368
400	422