CAZyme Information: PIS50122.1

Basic Information

• Species: [Candida] auris
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] auris
• CAZyme ID: PIS50122.1
• CAZy Family: CBM67|GH78
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381	PGLS01000006|CGC5	39353.92	5.3301

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CaurisB11221	5715	N/A	194	5521

• Gene Location: location=PGLS01000006:582157-583302(-)

Full Sequence      

MRAFIVSTLLASALAAPSGFHKHHHHQNEARAVVTTFRTVTVGANGEVKAAPTTVETSSA
STADAVSTSSTSSSSSSSATASSSTSASSSSSQASSQPSGGNGGSGGIAGDLSAFSDPTE
KFEDGVHDCDSLPTGQGVIAIDWLSDIKGGFSSVMNQNGDTSSTCKDGFYCSYACQAGMS
KTQWPSEQPSSGISVGGLYCKNGKLYRSNKDKDYLCEWGYQGTNFVSKIDKDIAICRTDY
PGSENMNIPTLLEAGKTAPVSVVNSDNYYMWKGGRSSTQYYVNNAGVSVEKGCIWGTAGS
GVGNWAPVVLGAGNTGGKTYLSLIPNPNNKDAPNYNVKIQGANGASTVGSCSYEDGSYKG
GHGSDGCTLTVTEGDAEFVFY

Enzyme Prediction     

No EC number prediction in PIS50122.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	71	381	1.5e-121	0.9801980198019802

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	1.44e-134	124	368	1	244	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEO23609.1|GH132	4.50e-243	1	381	1	381
QEL62477.1|GH132	8.02e-242	1	381	1	383
QWW25250.1|GH132	8.02e-242	1	381	1	383
QRG40034.1|GH132	2.05e-241	1	381	1	380
QWU89944.1|GH132	1.52e-201	1	381	1	388

PDB Hits     

PIS50122.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AKU5|UTH1_CANAL	3.86e-153	108	381	103	372	Secreted beta-glucosidase SIM1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SIM1 PE=1 SV=1
sp|P40472|SIM1_YEAST	3.63e-123	108	381	205	475	Probable secreted beta-glucosidase SIM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIM1 PE=1 SV=2
sp|B3LRC2|UTH1_YEAS1	5.01e-119	122	381	106	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=UTH1 PE=3 SV=1
sp|A7A003|UTH1_YEAS7	5.01e-119	122	381	106	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=UTH1 PE=3 SV=2
sp|B5VMJ0|UTH1_YEAS6	5.01e-119	122	381	106	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain AWRI1631) OX=545124 GN=UTH1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000633	0.999329	CS pos: 15-16. Pr: 0.9689

TMHMM  Annotations     

There is no transmembrane helices in PIS50122.1.