CAZyme Information: PHYSODRAFT_565469-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_565469-t26_1-p1
• CAZy Family: PL3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
419		48887.45	6.3370

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159162:1290756-1292015(+)

Full Sequence      

MLRHLVLLLSFLQLSALPPSCYADSDMLPPPPPVLGLSKADLCALDIDRSHHALGLVKVT
PEPPPAQKSGENRMYPRIFCFVNTISVHHKTRAQAVAETWGQRCDKLMFFSNTTDTIVVA
ANTDREQRYEVVKMDVIADHNHLWQKHKATLRYVHEHFRHDFDWFYKADDDAYVVMENLR
QYLRRPEILQAYKREPMQMGHRFNLTQDLVSYYIVDDSLENIWRSRWERWVFNSGGPGYV
MNRLYMDKIVNILPDWTCLSDRYSEMLPDDASISFCMMWHDVFPWDTRDHEGRERWHADK
PKGVYFTNPNRHDYWYVQYHYHIGGVRWKEGSAAPDSVAFHYISPPLMYHLERTLYLCRA
EDDVPDVAAFNAKYGLVIGDDVMVFQDMPQKKPFRAPVEEAPAETEAPGQAEGGANAER

Enzyme Prediction     

EC	2.4.1.122:25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT31	94	278	5.2e-17	0.9322916666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	2.46e-04	78	276	6	186	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ22190.1|GT31	3.13e-185	108	390	1	283
AIG56262.1|GT31	4.99e-144	35	376	22	341
CCA14287.1|GT31	1.17e-124	37	383	25	361
AIG55842.1|GT31	6.39e-108	42	362	29	309
CCA20921.1|GT31	2.66e-48	77	348	10	290

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7Q4I_A	1.53e-31	77	359	28	270	Chain A, Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 [Drosophila melanogaster],7Q4I_B Chain B, Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q18515|C1GLT_CAEEL	3.28e-32	77	356	105	344	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Caenorhabditis elegans OX=6239 GN=C38H2.2 PE=2 SV=2
sp|Q7K237|C1GLT_DROME	8.05e-31	46	359	59	342	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Drosophila melanogaster OX=7227 GN=C1GalTA PE=2 SV=1
sp|Q0VC84|C1GLT_BOVIN	2.97e-26	77	359	88	327	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Bos taurus OX=9913 GN=C1GALT1 PE=2 SV=1
sp|Q9NS00|C1GLT_HUMAN	3.78e-26	77	359	88	327	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=C1GALT1 PE=1 SV=1
sp|Q9JJ06|C1GLT_MOUSE	5.19e-26	77	359	88	327	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=C1galt1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000186	0.999789	CS pos: 23-24. Pr: 0.9759

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_565469-t26_1-p1.