CAZyme Information: PHYSODRAFT_564714-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_564714-t26_1-p1
• CAZy Family: PL3
• CAZyme Description: cellulase-9, endo-1,4-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
540		57823.92	4.1574

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159160:842358-844048(+)

Full Sequence      

MTLCGRLLGLLAAASALVTRCDAGSSFIDFRSVDGELKADNETFHIKGINWFGAETIELV
VQGLWPSATSIGDAMDLFTTYDINALRLPLAMDSVMDDPTVKSTQTGGSPSLAGKSYLEV
LDVIVREARKRNILIMFDSHRIEASEPDFPDIAVPDDITPALQKLATRYCDDPGAWNVFA
MDIKNEPKGKATWGKGDEDTDWNLQAAKIGNAVLKKCPRLLIFVEGVQTNIKGVSLEWGQ
AGGSLQGAKKYPVKLSNMERLVYSPHLISPGVDYKAPWWSDSNFPDNMPDLWDEYFGFVP
KETGQAVVVGSWGAHMKDKNKQWANAVSAYLEEKSIGSFYWAFNPQSADTGGFVKDDWVT
AIDERVALLESLPTTSVEDIVAIYAKCTKTCAGNGGCEGGKCICYSGWSGPQCEICSEGD
TGACNDMGTCLGNSTCACDDDADGKYCAGTECDEVDCGDGDNAGCFNGECTCLYNCVGNS
CTVCAVTESALADATNGATVLCDACDAQEQHDFSSAITSQSASVGSTVFAAIALIFSCFL

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_564714-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	40	352	3.7e-82	0.9903225806451613

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.19e-29	41	361	42	379	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	7.06e-24	63	345	17	270	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24085.1|GH5_1	5.43e-317	18	528	13	517
BAU13557.1|GH5_1	5.08e-64	37	372	59	395
ARV61444.1|CBM2|GH5_1	5.24e-64	37	375	64	404
UIZ28856.1|GH5_1	1.16e-63	28	360	5	350
AFZ01969.1|CBM2|GH5_1	2.28e-63	39	388	65	416

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W6M_A	2.83e-61	45	372	29	375	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3VVG_A	5.54e-61	45	372	29	375	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3QHM_A	3.03e-60	45	372	62	408	Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHM_B Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHM_C Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]
3QHO_A	3.03e-60	45	372	62	408	Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_B Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_C Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]
2ZUM_A	4.23e-60	45	372	62	408	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23548|GUN_PAEPO	3.60e-59	48	360	58	369	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P54583|GUN1_ACIC1	7.22e-53	37	360	55	379	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P19487|GUNA_XANCP	1.50e-47	11	372	10	368	Major extracellular endoglucanase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=engXCA PE=1 SV=2
sp|P10474|GUNB_CALSA	3.14e-39	40	370	641	994	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1
sp|Q05332|GUNG_ACET2	7.50e-34	46	370	62	441	Endoglucanase G OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000267	0.999709	CS pos: 23-24. Pr: 0.9422

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_564714-t26_1-p1.