CAZyme Information: PHYSODRAFT_561976-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_561976-t26_1-p1
• CAZy Family: PL3|PL3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303		33939.38	5.0093

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159156:1273712-1274752(-)

Full Sequence      

MGSASSKAGDANPKNLGADPNDPNAFPLHHHPYYNQAGHNQQQQGQQQQQQGRSFDGSDG
KHPRQQQQYYGAQHSASEAMEVDPPTESSSEMSYMDGEGNNAQSADLTVPPGEDVVPMVF
KWEHGGRNVFITGTFNGWDKQCPMHRSGNDFTYIANLTRGKHMYKFVVDDDWRFAPDQLT
MADVEGNVNNYVDVSDFAPLSDFDGKKPQDDDEDPENPYSRYIPEIDEYTKEPPPLPPHL
RHIILNKAPPTVDGRLLPVPQHVALNHLYCTAIKDGMMVLGITNRYKQKFVTTVYYSLMP
GAN

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_561976-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406865	AMPK1_CBM	2.41e-41	116	204	1	85	Glycogen recognition site of AMP-activated protein kinase. AMPK1_CBM is a family found in close association with AMPKBI pfam04739. The surface of AMPK1_CBM reveals a carbohydrate-binding pocket.
199889	E_set_AMPKbeta_like_N	1.47e-29	117	194	1	80	N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain of AMP-activated protein kinase beta subunit. E or "early" set domains are associated with the catalytic domain of AMP-activated protein kinase beta subunit glycogen binding domain at the N-terminal end. AMPK is a metabolic stress sensing protein that senses AMP/ATP and has recently been found to act as a glycogen sensor as well. The protein functions as an alpha-beta-gamma heterotrimer. This N-terminal domain is the glycogen binding domain of the beta subunit. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and isoamylase.
398422	AMPKBI	3.25e-27	239	297	9	68	5'-AMP-activated protein kinase beta subunit, interaction domain. This region is found in the beta subunit of the 5'-AMP-activated protein kinase complex, and its yeast homologs Sip1, Sip2 and Gal83, which are found in the SNF1 kinase complex. This region is sufficient for interaction of this subunit with the kinase complex, but is not solely responsible for the interaction, and the interaction partner is not known. The isoamylase N-terminal domain (pfam02922) is sometimes found in proteins belonging to this family.
214973	AMPKBI	3.68e-22	214	297	2	98	5'-AMP-activated protein kinase beta subunit, interation domain. This region is found in the beta subunit of the 5'-AMP-activated protein kinase complex, and its yeast homologues Sip1, Sip2 and Gal83, which are found in the SNF1 kinase complex. This region is sufficient for interaction of this subunit with the kinase complex, but is not solely responsible for the interaction, and the interaction partner is not known. The isoamylase N-terminal domain is sometimes found in proteins belonging to this family.
199892	E_set_Isoamylase_like_N	2.12e-04	123	172	10	63	N-terminal Early set domain associated with the catalytic domain of isoamylase-like (also called glycogen 6-glucanohydrolase) proteins. E or "early" set domains are associated with the catalytic domain of isoamylase-like proteins at the N-terminal end. Isoamylase is one of the starch-debranching enzymes that catalyze the hydrolysis of alpha-1,6-glucosidic linkages specific in alpha-glucans such as amylopectin or glycogen. Isoamylase contains a bound calcium ion, but this is not in the same position as the conserved calcium ion that has been reported in other alpha-amylase family enzymes. The N-terminal domain of isoamylase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and the beta subunit of AMP-activated protein kinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ25814.1|CBM48	1.53e-174	1	303	1	312
CCA27392.1|CBM48	1.18e-113	78	303	89	327
CCA26507.1|CBM48	7.94e-108	78	303	564	802
ABG33694.1|CBM48	1.92e-43	108	296	71	269
ABG33696.1|CBM48	1.92e-43	108	296	71	269

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T5T_B	2.64e-42	117	296	13	201	AMPK bound to allosteric activator [Rattus norvegicus]
4QFG_B	2.64e-42	117	296	13	201	Structure of AMPK in complex with STAUROSPORINE inhibitor and in the absence of a synthetic activator [Rattus norvegicus],4QFR_B Structure of AMPK in complex with Cl-A769662 activator and STAUROSPORINE inhibitor [Rattus norvegicus],4QFS_B Structure of AMPK in complex with Br2-A769662core activator and STAUROSPORINE inhibitor [Rattus norvegicus],5KQ5_B AMPK bound to allosteric activator [Rattus norvegicus],5UFU_B Structure of AMPK bound to activator [Rattus norvegicus]
6E4T_B	3.73e-42	117	296	13	201	Structure of AMPK bound to activator [Rattus norvegicus],6E4U_B Structure of AMPK bound to activator [Rattus norvegicus],6E4W_B Structure of AMPK bound to activator [Rattus norvegicus]
6B2E_B	1.20e-41	103	296	64	269	Structure of full length human AMPK (a2b2g1) in complex with a small molecule activator SC4. [Homo sapiens]
4REW_B	1.20e-41	117	296	3	194	Crystal structure of the non-phosphorylated human alpha1 beta2 gamma1 holo-AMPK complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6PAM0|AAKB2_MOUSE	3.62e-43	103	296	63	268	5'-AMP-activated protein kinase subunit beta-2 OS=Mus musculus OX=10090 GN=Prkab2 PE=1 SV=1
sp|Q9QZH4|AAKB2_RAT	3.95e-42	103	296	63	268	5'-AMP-activated protein kinase subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Prkab2 PE=1 SV=1
sp|O43741|AAKB2_HUMAN	1.13e-41	103	296	64	269	5'-AMP-activated protein kinase subunit beta-2 OS=Homo sapiens OX=9606 GN=PRKAB2 PE=1 SV=1
sp|Q5BIS9|AAKB1_BOVIN	1.51e-41	117	296	79	267	5'-AMP-activated protein kinase subunit beta-1 OS=Bos taurus OX=9913 GN=PRKAB1 PE=2 SV=3
sp|P80386|AAKB1_RAT	2.12e-41	117	296	79	267	5'-AMP-activated protein kinase subunit beta-1 OS=Rattus norvegicus OX=10116 GN=Prkab1 PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_561976-t26_1-p1.